HomeMy WebLinkAboutBOARD STANDING COMMITTEES - 06102019 - TWIC Agenda Pkt
TRANSPORTATION, WATER &
INFRASTRUCTURE COMMITTEE
June 10, 2019
9:00 A.M.
651 Pine Street, Room 101, Martinez
Supervisor Karen Mitchoff, Chair
Supervisor Candace Andersen, Vice Chair
Agenda
Items:
Items may be taken out of order based on the business of the day and preference
of the Committee
1.Introductions
2.Public comment on any item under the jurisdiction of the Committee and not on this
agenda (speakers may be limited to three minutes).
3. Administrative Items, if applicable. (John Cunningham, Department of Conservation
and Development)
4. REVIEW record of meeting for April 8, 2019, Transportation, Water and
infrastructure Committee Meeting. This record was prepared pursuant to the Better
Government Ordinance 95-6, Article 25-205 (d) of the Contra Costa County Ordinance
Code. Any handouts or printed copies of testimony distributed at the meeting will be
attached to this meeting record. (John Cunningham, Department of Conservation and
Development).
5. APPROVE and AUTHORIZE the Proposition 68 grant application, and DIRECT
staff as appropriate including sending the application to the full Board of
Supervisors with a recommendation to approve and authorize the Public Works
Director, or designee, to execute grant application documents to secure grant
funding with the California Natural Resources Agency, not to exceed $1,100,000,
for the Montarabay Green Infrastructure and Drainage Project.
(Carl J. Roner, Department of Public Works)
6. CONSIDER proposed ban of polystyrene food and beverage containers. (Tim
Jensen, Department of Public Works)
7. CONSIDER report on Local, State, Regional, and Federal Transportation
Related Legislative Issues and take ACTION as appropriate. (John Cunningham,
Department of Conservation and Development)
8. RECEIVE report, DISCUSS County priorities for the Contra Costa
06-10-19 TWIC Meeting Agenda
Packet Pg.1 of 192
8. RECEIVE report, DISCUSS County priorities for the Contra Costa
Transportation Authority's 2020 Transportation Expenditure Plan/Sales Tax and
DIRECT staff as appropriate. (John Kopchik, Department of Conservation and
Development).
9.The next meeting date is Thursday, July 18, 1:00 p.m. Please note this is outside the regular 2nd
Monday monthly schedule.
10.Adjourn
The Transportation, Water & Infrastructure Committee (TWIC) will provide reasonable
accommodations for persons with disabilities planning to attend TWIC meetings. Contact the staff
person listed below at least 72 hours before the meeting.
Any disclosable public records related to an open session item on a regular meeting agenda and
distributed by the County to a majority of members of the TWIC less than 96 hours prior to that
meeting are available for public inspection at the County Department of Conservation and
Development, 30 Muir Road, Martinez during normal business hours.
Public comment may be submitted via electronic mail on agenda items at least one full work day
prior to the published meeting time.
For Additional Information Contact:
John Cunningham, Committee Staff
Phone (925) 674-7833, Fax (925) 674-7250
john.cunningham@dcd.cccounty.us
06-10-19 TWIC Meeting Agenda
Packet Pg.2 of 192
Glossary of Acronyms, Abbreviations, and other Terms (in alphabetical order): Contra Costa County
has a policy of making limited use of acronyms, abbreviations, and industry-specific language in meetings of its
Board of Supervisors and Committees. Following is a list of commonly used abbreviations that may appear in
presentations and written materials at meetings of the Transportation, Water and Infrastructure Committee:
AB Assembly Bill
ABAG Association of Bay Area Governments
ACA Assembly Constitutional Amendment
ADA Americans with Disabilities Act of 1990
ALUC Airport Land Use Commission
AOB Area of Benefit
BAAQMD Bay Area Air Quality Management District
BART Bay Area Rapid Transit District
BATA Bay Area Toll Authority
BCDC Bay Conservation & Development Commission
BDCP Bay-Delta Conservation Plan
BGO Better Government Ordinance (Contra Costa County)
BOS Board of Supervisors
CALTRANS California Department of Transportation
CalWIN California Works Information Network
CalWORKS California Work Opportunity and Responsibility
to Kids
CAER Community Awareness Emergency Response
CAO County Administrative Officer or Office
CCTA Contra Costa Transportation Authority
CCWD Contra Costa Water District
CDBG Community Development Block Grant
CEQA California Environmental Quality Act
CFS Cubic Feet per Second (of water)
CPI Consumer Price Index
CSA County Service Area
CSAC California State Association of Counties
CTC California Transportation Commission
DCC Delta Counties Coalition
DCD Contra Costa County Dept. of Conservation & Development
DPC Delta Protection Commission
DSC Delta Stewardship Council
DWR California Department of Water Resources
EBMUD East Bay Municipal Utility District
EIR Environmental Impact Report (a state requirement)
EIS Environmental Impact Statement (a federal requirement)
EPA Environmental Protection Agency
FAA Federal Aviation Administration
FEMA Federal Emergency Management Agency
FTE Full Time Equivalent
FY Fiscal Year
GHAD Geologic Hazard Abatement District
GIS Geographic Information System
HBRR Highway Bridge Replacement and Rehabilitation
HOT High-Occupancy/Toll
HOV High-Occupancy-Vehicle
HSD Contra Costa County Health Services Department
HUD United States Department of Housing and Urban
Development
IPM Integrated Pest Management
ISO Industrial Safety Ordinance
JPA/JEPA Joint (Exercise of) Powers Authority or Agreement
Lamorinda Lafayette-Moraga-Orinda Area
LAFCo Local Agency Formation Commission
LCC League of California Cities
LTMS Long-Term Management Strategy
MAC Municipal Advisory Council
MAF Million Acre Feet (of water)
MBE Minority Business Enterprise
MOA Memorandum of Agreement
MOE Maintenance of Effort
MOU Memorandum of Understanding
MTC Metropolitan Transportation Commission
NACo National Association of Counties
NEPA National Environmental Protection Act
OES-EOC Office of Emergency Services-Emergency
Operations Center
PDA Priority Development Area
PWD Contra Costa County Public Works Department
RCRC Regional Council of Rural Counties
RDA Redevelopment Agency or Area
RFI Request For Information
RFP Request For Proposals
RFQ Request For Qualifications
SB Senate Bill
SBE Small Business Enterprise
SR2S Safe Routes to Schools
STIP State Transportation Improvement Program
SWAT Southwest Area Transportation Committee
TRANSPAC Transportation Partnership & Cooperation (Central)
TRANSPLAN Transportation Planning Committee (East County)
TWIC Transportation, Water and Infrastructure Committee
USACE United States Army Corps of Engineers
WBE Women-Owned Business Enterprise
WCCTAC West Contra Costa Transportation Advisory
Committee
WETA Water Emergency Transportation Authority
WRDA Water Resources Development Act
06-10-19 TWIC Meeting Agenda
Packet Pg.3 of 192
TRANSPORTATION, WATER &
INFRASTRUCTURE COMMITTEE 3.
Meeting Date:06/10/2019
Subject:Administrative Items, if applicable.
Submitted For: TRANSPORTATION, WATER & INFRASTRUCTURE
COMMITTEE,
Department:Conservation & Development
Referral No.: N/A
Referral Name: N/A
Presenter: John Cunningham, DCD Contact: John Cunningham
(925)674-7833
Referral History:
This is an Administrative Item of the Committee.
Referral Update:
Staff will review any items related to the conduct of Committee business.
Recommendation(s)/Next Step(s):
CONSIDER Administrative items and Take ACTION as appropriate.
Fiscal Impact (if any):
N/A
Attachments
No file(s) attached.
06-10-19 TWIC Meeting Agenda
Packet Pg.4 of 192
TRANSPORTATION, WATER &
INFRASTRUCTURE COMMITTEE 4.
Meeting Date:06/10/2019
Subject:REVIEW record of meeting for April 8, 2019, Transportation, Water
and Infrastructure Meeting.
Submitted For: TRANSPORTATION, WATER & INFRASTRUCTURE
COMMITTEE,
Department:Conservation & Development
Referral No.: N/A
Referral Name: N/A
Presenter: John Cunningham, DCD Contact: John Cunningham
(925)674-7833
Referral History:
County Ordinance (Better Government Ordinance 95-6, Article 25-205, [d]) requires that each
County Body keep a record of its meetings. Though the record need not be verbatim, it must
accurately reflect the agenda and the decisions made in the meeting.
Referral Update:
Any handouts or printed copies of testimony distributed at the meeting will be attached to this
meeting record. Links to the agenda and minutes will be available at the TWI Committee web
page: http://www.cccounty.us/4327/Transportation-Water-Infrastructure
Recommendation(s)/Next Step(s):
Staff recommends approval of the attached Record of Action for the April 8, 2019, Committee
Meeting with any necessary corrections.
Fiscal Impact (if any):
N/A
Attachments
04-08-19 TWIC Meeting Record
04-08-19 TWIC Sign-In Sheet
06-10-19 TWIC Meeting Agenda
Packet Pg.5 of 192
D R A F T
TRANSPORTATION, WATER & INFRASTRUCTURE COMMITTEE
April 8, 2019
9:00 A.M.
651 Pine Street, Room 101, Martinez
Supervisor Karen Mitchoff, Chair
Supervisor Candace Andersen, Vice Chair
Agenda Items:Items may be taken out of order based on the business of the day and preference of the Committee
Present: Karen Mitchoff, Chair
Candace Andersen, Vice Chair
Attendees: John Cunningham, CC County DCD
Maureen Toms, CC County DCD
Jody London, CC County DCD
Robert Sarmiento, CC County DCD
Shirley, Krohn, ACOA and CSL
Alicia Nuchols, Office of Supervisor Diane Burgis
Brian Balbas, CC County Dept. of Publi
Carl Roner, CC County Dept. of Public
Nancy C. Wein, Jerry Fahy, CC County Dept. of Publ
Jerry Fahy, CC County Dept. of Public Works
1.Introductions
2.Public comment on any item under the jurisdiction of the Committee and not on this agenda (speakers may be
limited to three minutes).
Shirley Krohn, (Contra Costa County Advisory Council on Aging, California Senior Legislature) suggested
that a presentation to the Board of Supervisors on the California Senior Legislature would be useful. The
Committee agreed and supported the suggestion. The Committee Members requested that Ms. Krohn work
through either one of their offices or through the Chief of Staff for the current Chair of the BOS, John
Gioia.
3.CONSIDER Administrative items and Take ACTION as appropriate.
4.Staff recommends approval of the attached Record of Action for the February 11, 2019, Committee Meeting
with any necessary corrections.
The Committee unanimously APPROVED the meeting record.
5.REVIEW the recommended list of Road Maintenance and Rehabilitation Account (RMRA)(SB1) funded road
projects, RECEIVE public comment and DIRECT staff to perform any changes or revisions to the
recommended project list. RECOMMEND the Board of Supervisors approve project list, and direct staff to
proceed with submitting the Fiscal Year 2019/2020 list of projects to the California Transportation Commission
prior to the May 1, 2019 submittal deadline for approval.
The Committee unanimously APPROVED the staff recommendations further directing staff to bring the
item to the Board of Supervisors on consent.
6.ACCEPT report on 2018 Bike-to-Work Day and DIRECT staff as appropriate, including 1) recommending
06-10-19 TWIC Meeting Agenda
Packet Pg.6 of 192
6.ACCEPT report on 2018 Bike-to-Work Day and DIRECT staff as appropriate, including 1) recommending
measures that will increase the County's participation in future Bike-to-Work Days and 2) bringing this report to
the full Board of Supervisors.
The Committee RECEIVED the report and directed staff to bring a brief report to the full Board of
Supervisors at their May 7th meeting, and initiate event planning earlier next year in order to foster greater
competition among departments.
7.REVIEW the Proposition 1 grant application, and DIRECT staff as appropriate including sending the
application to the full Board of Supervisors with a recommendation to approve and authorize the Public
Works Director, or designee, to execute grant application documents to secure grant funding with the
California State Coastal Conservancy, not to exceed $200,000, for the Montarabay Green Infrastructure
and Drainage Project.
The Committee REVIEWED the grant application and unanimously APPROVED the staff
recommendations.
8.CONSIDER report on Local, Regional, State, and Federal Transportation Related Legislative Issues and take
ACTION as appropriate.
The Committee RECEIVED the report and recommended positions on AB 1568 (OPPOSE must go to
BOS), SB 137 (SUPPORT, existing stated position), and SB 228 (SUPPORT, existing position per County
State Legislative Platform).
9.The next meeting is currently scheduled for Monday, May 13, 2019.
10.Adjourn
The Transportation, Water & Infrastructure Committee (TWIC) will provide reasonable accommodations for persons with disabilities planning to attend TWIC meetings. Contact the
staff person listed below at least 72 hours before the meeting.
Any disclosable public records related to an open session item on a regular meeting agenda and distributed by the County to a majority of members of the TWIC less than 96 hours prior
to that meeting are available for public inspection at the County Department of Conservation and Development, 30 Muir Road, Martinez during normal business hours.
Public comment may be submitted via electronic mail on agenda items at least one full work day prior to the published meeting time.
For Additional Information Contact:
John Cunningham, Committee Staff
06-10-19 TWIC Meeting Agenda
Packet Pg.7 of 192
06-10-19 TWIC Meeting Agenda
Packet Pg.8 of 192
TRANSPORTATION, WATER &
INFRASTRUCTURE COMMITTEE 5.
Meeting Date:06/10/2019
Subject:APPROVE and AUTHORIZE to secure Proposition 68 grant funding with
the California Natural Resources Agency.
Submitted For: Brian M. Balbas, Public Works Director/Chief Engineer
Department:Public Works
Referral No.: 2
Referral Name: Review application for transporation, water and infrastructure grants to be
prepared by Public Works & Conservation and Development Departments.
Presenter: Carl J. Roner, Public Works
Department
Contact: Carl Roner
(925)313-2213
Referral History:
N/A
Referral Update:
The purpose of the proposed California Natural Resources Agency Proposition 68 Grant* will be
to fund the design and construction of a green infrastructure project which will provide drainage
to the Montarabay parking lot. The facility’s parking lot, which is 1.82 acres in size, is completely
paved and does not have any drainage facilities. During much of the winter it is flooded by
rainfall, restricting parking and access to the community center. The adjacent ballfields do not dry
out until late summer. These flooding events limit public access to the facility during the winter
months and interfere with food distribution events that are held in the Montarabay parking lot on a
monthly basis.
The overall site is set between higher ground to the west and elevated railroad embankments to
the north and south. The only way to provide for surface runoff drainage is to construct a pipeline
to Garrity Creek, to the east. Due to the large surface area of the parking lot, the former industrial
use of the site as a sewage treatment plant, and the sensitivity of adjacent Garrity Creek, which
discharges to San Pablo Bay, any drainage improvements to the parking lot should incorporate
bioswales and other green infrastructure techniques to treat surface drainage prior to discharge.
Bioswales are landscape elements designed to concentrate or remove debris and pollution out of
surface runoff water.
Placing bioswales in the parking lot to break up and slow down traffic (precluding illegal street
racing) would be a benefit to the users of the community center, particularly the less mobile
elderly. Bioswales would also make the site more attractive and parklike, adding an element of
urban greening to the site requested by the grant application.
06-10-19 TWIC Meeting Agenda
Packet Pg.9 of 192
The grant will pay for the engineering, landscape design, permitting, and construction for the
bioswales and drainage pipeline.
* California Natural Resources Agency Proposition 68 grants fund green infrastructure.
Recommendation(s)/Next Step(s):
APPROVE & AUTHORIZE the Proposition 68 grant application, and DIRECT staff as
appropriate including sending the application to the full Board of Supervisors with a
recommendation to approve and authorize the Public Works Director, or designee, to
execute grant application documents to secure grant funding with the California Natural
Resources Agency, not to exceed $1,100,000, for the Montarabay Green Infrastructure and
Drainage Project.
Fiscal Impact (if any):
None. The grant will pay for the engineering, landscape design, permitting, and construction for
the bioswales and the drainage pipeline.
Attachments
No file(s) attached.
06-10-19 TWIC Meeting Agenda
Packet Pg.10 of 192
TRANSPORTATION, WATER &
INFRASTRUCTURE COMMITTEE 6.
Meeting Date:06/10/2019
Subject:CONSIDER proposed ban of polystyrene food and beverage containers.
Submitted For: TRANSPORTATION, WATER & INFRASTRUCTURE COMMITTEE,
Department:Conservation & Development
Referral No.: 5
Referral Name: Review issues associated with the health of the San Francisco Bay and
Delta, including water quality.
Presenter: Tim Jensen, Public Works Department Contact: Cece Sellgren
(925)313-2296
Referral History:
The Regional Water Quality Control Boards issue the County a stormwater permit on a five-year recurring cycle.
The first permit was issued in 1993 and the current permit was issued in November 2015. The objective of the
permit is to reduce pollutants in stormwater to improve stormwater quality, and increase stormwater infiltration into
soils to improve watershed health.
Trash is considered a pollutant and the stormwater permit includes ambitious trash reduction targets. To meet the
trash reduction targets, the County prepared trash reduction plans that include a variety of control measures. One of
the control measures to reduce trash is to ban polystyrene food and beverage containers, as polystyrene is light and
easily blown into waterways where it tends to break down into smaller pieces that are difficult to remove from the
environment.
This issue was last heard at TWIC in October 2018, staff was directed to bring a full report to the BOS.
Referral Update:
The new stormwater permit, referred to as the Municipal Regional Permit 2.0, follows the prior Municipal Regional
Permit 1.0 issued at the end of 2009. The Committee has reviewed several issues related to the stormwater permit,
and Board members have testified before the Regional Water Board several times describing the impacts their
stormwater permit has on County operations and the County budget.
Although the stormwater permit is a familiar topic to the Committee, this is the first time a proposed ban of
polystyrene food and beverage containers has been before the Committee for consideration.
Recommendation(s)/Next Step(s):
CONSIDER a proposed ban of polystyrene food and beverage containers and the policy implications and objectives
of a ban, PROVIDE staff with policy direction to develop a draft ordinance, and, if necessary, FORWARD the
recommended policy direction to the full Board for consideration and concurrence.
Fiscal Impact (if any):
06-10-19 TWIC Meeting Agenda
Packet Pg.11 of 192
Fiscal Impact (if any):
The cost to develop a polystyrene ban is estimated to be $75,000. The annual cost to enforce a polystyrene ban is
estimated to be $25,000 for Option One. Option Two will cost more than Option One to administer and enforce,
how much more is hard to determine given the variety of possible permutations of Option Two and the additional
research required depending on the permutation. [100% County Stormwater Utility Funds]
Attachments
Memo to TWIC 11-8-18
Exhibit 1 Provisions
Exhibit 2 Communication Plan
Exhibit 3 Handout
Exhibit 4 Mailing 8-23-18
Exhibit 5 Mailing 10-15-18
Exhibit 6 CA Restaurant Assoc ltr
Exhibit 7 Goudey-London email 10-10-18
06-10-19 TWIC Meeting Agenda
Packet Pg.12 of 192
06-10-19 TWIC Meeting Agenda
Packet Pg.13 of 192
06-10-19 TWIC Meeting Agenda
Packet Pg.14 of 192
06-10-19 TWIC Meeting Agenda
Packet Pg.15 of 192
06-10-19 TWIC Meeting Agenda
Packet Pg.16 of 192
06-10-19 TWIC Meeting Agenda
Packet Pg.17 of 192
06-10-19 TWIC Meeting Agenda
Packet Pg.18 of 192
06-10-19 TWIC Meeting Agenda
Packet Pg.19 of 192
06-10-19 TWIC Meeting Agenda
Packet Pg.20 of 192
06-10-19 TWIC Meeting Agenda
Packet Pg.21 of 192
06-10-19 TWIC Meeting Agenda
Packet Pg.22 of 192
06-10-19 TWIC Meeting Agenda
Packet Pg.23 of 192
06-10-19 TWIC Meeting Agenda
Packet Pg.24 of 192
06-10-19 TWIC Meeting Agenda
Packet Pg.25 of 192
06-10-19 TWIC Meeting Agenda
Packet Pg.26 of 192
06-10-19 TWIC Meeting Agenda
Packet Pg.27 of 192
06-10-19 TWIC Meeting Agenda
Packet Pg.28 of 192
06-10-19 TWIC Meeting Agenda
Packet Pg.29 of 192
06-10-19 TWIC Meeting Agenda
Packet Pg.30 of 192
06-10-19 TWIC Meeting Agenda
Packet Pg.31 of 192
06-10-19 TWIC Meeting Agenda
Packet Pg.32 of 192
06-10-19 TWIC Meeting Agenda
Packet Pg.33 of 192
06-10-19 TWIC Meeting Agenda
Packet Pg.34 of 192
TRANSPORTATION, WATER &
INFRASTRUCTURE COMMITTEE 7.
Meeting Date:06/10/2019
Subject:CONSIDER report: Local, Regional, State, and Federal Transportation
Issues: Legislation, Studies, Miscellaneous Updates, take ACTION as
Appropriate
Submitted For: TRANSPORTATION, WATER & INFRASTRUCTURE COMMITTEE,
Department:Conservation & Development
Referral No.: 1
Referral Name: REVIEW legislative matters on transportation, water, and infrastructure.
Presenter: John Cunningham, DCD Contact: John Cunningham
(925)674-7883
Referral History:
This is a standing item on the Transportation, Water, and Infrastructure Committee referral list
and meeting agenda.
Referral Update:
In developing transportation related issues and proposals to bring forward for consideration by
TWIC, staff receives input from the Board of Supervisors (BOS), references the County's adopted
Legislative Platforms, coordinates with our legislative advocates, partner agencies and
organizations, and consults with the Committee itself.
This report includes four sections, 1: LOCAL, 2: REGIONAL, 3: STATE, and 4: FEDERAL .
1. LOCAL
No report in June.
2. REGIONAL
No report in June.
3. STATE
Mr. Watts will attend the June Committee meeting to provide a report.
06-10-19 TWIC Meeting Agenda
Packet Pg.35 of 192
Contra Costa County Specific Legislation of Interest:
AB 1025 (Grayson): TRANSPORTATION: California Transportation Commission: San Ramon Branch
Corridor: Reimbursement aka "The Iron Horse Bill".
Status: As of the submission of this report the Iron Horse Bill had been ordered to the Senate (5-23) and is
awaiting Committee referral.
Discussion : Mr. Watts will provide an update on the status of the bill.
Other
County staff brought the bill to the Iron Horse Corridor Management Program Advisory Committee in May
for discussion and input. The IHC Committee was supportive of the changes reflected in the bill, the addition
of the Committee seat for the Contra Costa Transportation Authority and the addition to the work program to
consider proposals to study new and emerging mobility modes and technologies in the corridor.
AB 970 (Salas): California Department of Aging: Grants: Transportation
Status: As of the submission of this report AB 970 had been ordered to the Senate and was dual referred to
Human Services and Environmental Quality. The bill will be heard at the Senate Human Services Committee
on June 10th at 3:00.
Discussion : AB 970 was similar to a bill developed by Contra Costa County in that it accessed Cap and
Trade revenue to fund improvements to transportation services for seniors & persons with disabilities (SPD).
Relative to the County proposal, the bill had limited language relative to the administration of the grant
program and rationale for accessing Cap and Trade revenue.
Given that 1) the County had that additional detail already developed, and 2) more critically we did not
secure an author for our own bill, the County transmitted a "Support if Amended" letter and engaged the
Author's staff. The Author, his staff, and the legislative analyst's office have been receptive to input from the
County, the bill has gone through several revisions reflecting that input.
Additional revisions will be necessary in order for the County to adopt a support position. A concern is that if
the legislation is enacted without appropriate revisions it will make subequent legislation accessing Cap and
Trade revenue for the SPD population much more difficult.
Other:
• MTC staff is preparing a "Support if Amended" position for consideration by their Legislation Committee
and Board.
Attached: June TWIC Report - Legislation of Interest.
4. FEDERAL
No written report in June.
Recommendation(s)/Next Step(s):
CONSIDER report on Local, Regional, State, and Federal Transportation Related Legislative
Issues and take ACTION as appropriate.
Fiscal Impact (if any):
There is no fiscal impact.
Attachments
AB 970 - Salas Bill Text
06-10-19 TWIC Meeting Agenda
Packet Pg.36 of 192
AB 1025 Iron Horse Bill Text
June TWIC - Legislation of Potential Interest
June TWIC Memorandum
06-10-19 TWIC Meeting Agenda
Packet Pg.37 of 192
AMENDED IN ASSEMBLY APRIL 12, 2019
AMENDED IN ASSEMBLY MARCH 20, 2019
california legislature—2019–20 regular session
ASSEMBLY BILL No. 970
Introduced by Assembly Member Salas
February 21, 2019
An act to add Chapter 8.5 (commencing with Section 9580) to
Division 8.5 of the Welfare and Institutions Code, relating to aging.
legislative counsel’s digest
AB 970, as amended, Salas. California Department of Aging: grants:
transportation.
Existing law, the California Global Warming Solutions Act of 2006,
designates the State Air Resources Board as the state agency charged
with monitoring and regulating sources of emissions of greenhouse
gases. The act authorizes the state board to include the use of
market-based compliance mechanisms. Existing law requires all moneys,
except for fines and penalties, collected by the state board as part of a
market-based compliance mechanism to be deposited in the Greenhouse
Gas Reduction Fund and to be available for appropriation.
Existing law establishes the Air Quality Improvement Program, which
is administered by the state board for the purpose of funding projects
related to, among other things, the reduction of criteria air pollutants
and improvement of air quality. Existing law requires that moneys in
the Air Quality Improvement Fund, upon appropriation by the
Legislature, be expended by the state board in accordance with the
program.
06-10-19 TWIC Meeting Agenda
Packet Pg.38 of 192
Existing law requires the California Department of Aging to designate
various private nonprofit or public agencies as area agencies on aging
to work for the interests of older Californians within a planning and
service area and provide a broad array of social and nutritional services.
Existing law states that the mission of the department is to provide
leadership to the area agencies on aging in developing systems of home-
and community-based services that maintain individuals in their own
homes or the least restrictive homelike environments. Existing law
establishes certain wellness, injury prevention, and other programs
within the department to serve both older individuals and persons with
a disability, as defined.
This bill would require the department to administer a grant program
to receive applications from eligible applicants, including, but not
limited to, area agencies on aging and public transit operators, to fund
transportation to and from nonemergency medical services for older
individuals and persons with a disability who reside in rural, desert, or
mountain areas within a planning and service area, disability, for the
purpose of reducing greenhouse gas emissions. The bill would require
that transportation be made available using the purchase, lease,
operation, or maintenance of zero-emission or near-zero-emission
vehicles with a capacity for 7, 12, or 15 passengers.
The bill would authorize the allocation of moneys from the
Greenhouse Gas Reduction Fund and the Air Quality Improvement
Fund, upon appropriation by the Legislature, to fund the grant program.
Vote: majority. Appropriation: no. Fiscal committee: yes.
State-mandated local program: no.
The people of the State of California do enact as follows:
line 1 SECTION 1. Chapter 8.5 (commencing with Section 9580) is
line 2 added to Division 8.5 of the Welfare and Institutions Code, to read:
line 3
line 4 Chapter 8.5. Transportation for Medical Services
line 5
line 6 9580. (a) The department
line 7 9580. (a) For purposes of this section, “near-zero-emission
line 8 vehicle” and “zero-emission vehicle” have the same meanings as
line 9 those terms are defined in Section 44258 of the Health and Safety
line 10 Code.
2
06-10-19 TWIC Meeting Agenda
Packet Pg.39 of 192
line 1 (b) The department shall administer a grant program to fund
line 2 transportation to and from nonemergency medical services for
line 3 older individuals, as defined in Section 9018, and persons with a
line 4 disability, as defined in Section 9653, pursuant to this department,
line 5 in coordination with the State Air Resources Board and the State
line 6 Department of Health Care Services, section for the purpose of
line 7 reducing greenhouse gas emissions.
line 8 (b) Area agencies on aging may apply for grants from the
line 9 department pursuant to this section. An area agency on aging that
line 10 has been awarded a grant shall use the funds to provide
line 11 transportation as described in subdivision (c).
line 12 (c) Eligible applicants who may apply for grants from the
line 13 department pursuant to this section shall include, but not be limited
line 14 to, all of the following:
line 15 (1) Local or regional transportation agencies that provide
line 16 transportation services to seniors and persons with disabilities.
line 17 (2) Area agencies on aging.
line 18 (3) Counties.
line 19 (4) Public transit operators.
line 20 (d) An applicant that has been awarded a grant shall use the
line 21 funds to provide transportation services as described in subdivision
line 22 (e).
line 23 (c)
line 24 (e) (1) Eligible transportation includes transportation to and
line 25 from nonemergency medical services for older individuals and
line 26 persons with a disability, as described in subdivision (a), who
line 27 reside in rural, desert, or mountain areas within a planning and
line 28 service area. (b).
line 29 (2) Eligible transportation shall be made available using the
line 30 purchase, lease, operation, or maintenance of zero-emission or
line 31 near-zero-emission vehicles with a capacity for 7, 12, or 15
line 32 passengers.
line 33 (d)
line 34 (f) (1) The department may use moneys allocated to the grant
line 35 program pursuant to Section 9581 to cover reasonable
line 36 administrative costs incurred by the department under this section.
line 37 (2) An area agency on aging applicant that has been awarded
line 38 a grant may use grant moneys to cover reasonable administrative
line 39 costs incurred by the area agency on aging applicant under this
line 40 section.
3
06-10-19 TWIC Meeting Agenda
Packet Pg.40 of 192
line 1 9581. Moneys from the Greenhouse Gas Reduction Fund,
line 2 created pursuant to Section 16428.8 of the Government Code, and
line 3 the Air Quality Improvement Fund, created pursuant to Section
line 4 44274.5 of the Health and Safety Code, Code may be allocated,
line 5 upon appropriation by the Legislature, to fund the grant program
line 6 described in Section 9580.
O
4
06-10-19 TWIC Meeting Agenda
Packet Pg.41 of 192
AMENDED IN ASSEMBLY MARCH 26, 2019
california legislature—2019–20 regular session
ASSEMBLY BILL No. 1025
Introduced by Assembly Member Grayson
February 21, 2019
An act to amend Section 75221 of the Public Resources Code, relating
to transportation. An act relating to transportation.
legislative counsel’s digest
AB 1025, as amended, Grayson. Transit and Intercity Rail Capital
Program. Transportation: California Transportation Commission: San
Ramon Branch Corridor: reimbursement.
Existing law creates the California Transportation Commission, with
various powers and duties relative to the programming of transportation
capital projects and the allocation of funds to those projects, pursuant
to the state transportation improvement program and various other
transportation funding programs. Through certain commission
resolutions, the commission allocated moneys appropriated to it in the
1980s from the Transportation Planning and Development Account to
the County of Contra Costa for the acquisition of a specified
right-of-way, and for associated projects, relating to the San Ramon
Branch Corridor. Those resolutions require the county to reimburse
the state if the county fails to meet specified conditions.
This bill would relinquish the rights of the state to reimbursement
pursuant to those resolutions.
This bill would also require the County of Contra Costa to revise the
bylaws of the Iron Horse Corridor Management Program Advisory
Committee to: (1) include a seat for a Contra Costa Transportation
Authority representative, (2) expand the management program elements
06-10-19 TWIC Meeting Agenda
Packet Pg.42 of 192
to include a new, 7th element that considers proposals to study new
and emerging mobility modes and technologies in the corridor, and (3)
include a new task in the committee’s work program to recommend a
framework for acting on these proposals. The bill would also make
findings and declarations in support of these requirements.
By imposing new duties on local public officials, the bill would create
a state-mandated local program.
The California Constitution requires the state to reimburse local
agencies and school districts for certain costs mandated by the state.
Statutory provisions establish procedures for making that
reimbursement.
This bill would provide that, if the Commission on State Mandates
determines that the bill contains costs mandated by the state,
reimbursement for those costs shall be made pursuant to the statutory
provisions noted above.
Existing law establishes the Transit and Intercity Rail Capital Program
to fund transformative capital improvements that will modernize
California’s intercity, commuter, and urban rail systems and bus and
ferry transit systems to achieve certain policy objectives. Existing law
prescribes the eligibility requirements for projects under the program.
This bill would make a nonsubstantive change to the provision related
to project eligibility.
Vote: majority. Appropriation: no. Fiscal committee: no yes.
State-mandated local program: no yes.
The people of the State of California do enact as follows:
line 1 SECTION 1. The Legislature finds and declares all of the
line 2 following:
line 3 (a) The Southern Pacific Railroad’s San Ramon Branch Line
line 4 started service in 1891. That section of the rail line in the County
line 5 of Contra Costa extended 18.5 miles from the City of Concord to
line 6 the Alameda County line.
line 7 (b) In 1978, Southern Pacific Railroad received federal
line 8 permission to abandon the rail line. The line’s railroad tracks
line 9 were removed over the following one to two years.
line 10 (c) The County of Contra Costa obtained $10,579,000 in
line 11 Transportation Planning and Development Account (TP&D) grants
line 12 starting in 1982 to fund a feasibility study and pay for the partial
line 13 acquisition of the San Ramon Branch Corridor’s right-of-way,
2
06-10-19 TWIC Meeting Agenda
Packet Pg.43 of 192
line 1 including a 1982 TP&D grant, MT-83-16, for $2,000,000, a 1985
line 2 TP&D grant, MT-86-1, for $2,579,000, and a 1986 TP&D grant,
line 3 MT-87-2, for $6,000,000.
line 4 (d) The grants’ requirements included (1) the conduct of a
line 5 feasibility study with costs to be shared equally by state and
line 6 nonstate sources, and (2) the planning and construction of a
line 7 busway or exclusive mass transit guideway. The feasibility study
line 8 investigated possible transportation improvements within the
line 9 right-of-way and the Interstate Route 680 corridor between the
line 10 Cities of Concord and Pleasanton.
line 11 (e) The County of Contra Costa raised some of the nonstate
line 12 moneys necessary to purchase the right-of-way through the sale
line 13 of easements to the Central Contra Costa Sanitary District and
line 14 the Contra Costa County Flood Control District. The Contra Costa
line 15 County Redevelopment Agency (RDA) also acquired portions of
line 16 the right-of-way in the redevelopment area. The RDA used a
line 17 portion of that right-of-way to construct bicycle and pedestrian
line 18 access improvements, including a bridge exclusively for bicycles
line 19 and pedestrians crossing over a major arterial that serves the
line 20 Pleasant Hill/Contra Costa Centre Bay Area Rapid Transit (BART)
line 21 station.
line 22 (f) In 1986 the County of Contra Costa entered into a license
line 23 agreement with East Bay Regional Park District to operate a
line 24 10-foot wide paved multiuse trail within the right-of-way called
line 25 the “Iron Horse Regional Trail.” On July 5, 2017, the East Bay
line 26 Regional Park District’s Board of Directors authorized an electric
line 27 bicycle pilot program, for Class 1 and 2 E-bikes, on the Iron Horse
line 28 Regional Trail. On October 18, 2017, the Contra Costa
line 29 Transportation Authority appropriated $350,000 in funds from
line 30 Measure J, the local transportation sales tax initiative approved
line 31 by the voters in November 2004, to conduct the Iron Horse Active
line 32 Transportation Corridor Study.
line 33 (g) Due to a combination of an acute shortage of automobile
line 34 parking at the Pleasant Hill/Contra Costa Centre BART station
line 35 and the immediate proximity of the Iron Horse Regional Trail, a
line 36 significant expansion of bicycle accommodation in the station area
line 37 has taken place to improve BART station access. New
line 38 accommodations include the installation of a 215-space secure
line 39 bike station, the placement of a fleet of docked and dockless bikes,
line 40 and improvements to the surrounding infrastructure to
3
06-10-19 TWIC Meeting Agenda
Packet Pg.44 of 192
line 1 accommodate bikes. These investments concurrently rely on, and
line 2 increase the usage of, the Iron Horse Regional Trail.
line 3 (h) When the County of Contra Costa purchased the
line 4 right-of-way, water lines and a high pressure gas line were already
line 5 in place in the right-of-way. The county has expanded access to
line 6 utilities by authorizing the installation of a reclaimed waterline,
line 7 a fiber optic line, sewer lines, and additional water lines.
line 8 (i) Consistent with requirements in the grants described in
line 9 subdivision (c), the County of Contra Costa has identified, and
line 10 restricted the use of, a 34-foot wide transit area throughout the
line 11 right-of-way for a busway or exclusive mass transit guideway while
line 12 continuing to use and manage the right-of-way, emphasizing active
line 13 transportation projects and the general benefit to the public. The
line 14 Board of Supervisors of the County of Contra Costa is advised on
line 15 this use and management by the multijurisdictional Iron Horse
line 16 Corridor Management Program Advisory Committee that is
line 17 comprised of representatives from the community of Alamo, the
line 18 City of Concord, the City of San Ramon, the Town of Danville, the
line 19 City of Walnut Creek, and the City of Pleasant Hill, the board of
line 20 supervisors, and the East Bay Regional Park District.
line 21 (j) The Iron Horse Regional Trail is one of the largest and oldest
line 22 multiuse trails in the San Francisco Bay area, is the East Bay
line 23 Regional Park District’s most used trail, and has evolved into a
line 24 cherished community element. The County of Contra Costa,
line 25 through grant funding and project sponsors, constructed alternate
line 26 trails in several sections of the right-of-way allowing walkers and
line 27 joggers to use the right-of-way separately from faster moving
line 28 cyclists and other wheeled modes of transportation.
line 29 (k) The County of Contra Costa receives requests from adjacent
line 30 cities and companies to make improvements to the right-of-way.
line 31 Approving the requests continues to be a challenge while
line 32 maintaining the 34-foot wide clear area to accommodate the
line 33 busway or exclusive mass transit guideway.
line 34 (l) While there is potential for emerging transportation
line 35 technologies to be implemented in the corridor, a busway or
line 36 exclusive mass transit guideway is no longer a best practice or
line 37 appropriate use of the right-of-way. The right-of-way is used
line 38 annually by over one million recreational users, commuters, and
line 39 students for access to 11 schools, three BART stations that face
line 40 severe parking shortages, numerous commercial and recreational
4
06-10-19 TWIC Meeting Agenda
Packet Pg.45 of 192
line 1 activity centers, as well as other regional trails which together
line 2 with the Iron Horse Trail form a sophisticated countywide active
line 3 transportation network comprised of the Contra Costa Canal Trail
line 4 and two other trails to which connections are planned, the
line 5 Lafayette-Moraga Regional Trail and the Delta de Anza Regional
line 6 Trail.
line 7 (m) With the evolution of new mobility technologies, including
line 8 ride hailing, transportation network companies, autonomous
line 9 vehicles, miscellaneous wheeled devices, and other “last mile”
line 10 options, an investment in a busway or exclusive mass transit
line 11 guideway in a corridor bounded by the BART commuter rail line
line 12 in both the north, the Pittsburgh-Bay Point-SFO Line, and in the
line 13 south, the Dublin-Pleasanton-Daly City Line, is unlikely to meet
line 14 cost-benefit expectations.
line 15 (n) The construction of a busway or exclusive mass transit
line 16 guideway is no longer operationally or financially viable due to
line 17 the cost of developing these modes of transportation in compact,
line 18 established communities with substantial density immediately
line 19 adjacent to urban and suburban uses, and the corresponding
line 20 density of road and trail crossings, the overwhelming presence of
line 21 active mode users, and the status in the community of the corridor
line 22 and trail as a linear park, recreational, and multiuse facility.
line 23 (o) Above and beyond the requirements to study and construct
line 24 the busway or exclusive mass transit guideway, the Contra Costa
line 25 Transportation Authority has conducted comprehensive analyses
line 26 in the broader travel corridor, the “I-680 Investment Options
line 27 Analysis” (2003) and the “I-680 Transit Investment/Congestion
line 28 Relief Options Study” (2015). Neither effort recommended the use
line 29 of the Iron Horse right-of-way as a viable option to address
line 30 congestion on I-680. With the rapid emergence of new mobility
line 31 options, an update to these prior studies is warranted.
line 32 (p) The County of Contra Costa remains committed to
line 33 continuing its good faith effort in working with corridor-adjacent
line 34 cities and the Contra Costa Transportation Authority, to
line 35 collaboratively invest, study, and develop the corridor for the
line 36 public benefit, including the examination of new transportation
line 37 modes and technologies as they evolve. This commitment is
line 38 evidenced by the Iron Horse Active Transportation Corridor Study
line 39 currently underway. The study includes an examination of the
line 40 accommodation of shared autonomous vehicles. Study oversight
5
06-10-19 TWIC Meeting Agenda
Packet Pg.46 of 192
line 1 includes representatives from the Contra Costa Transportation
line 2 Authority, corridor cities, and the East Bay Regional Park District.
line 3 SEC. 2. (a) The County of Contra Costa shall do both of the
line 4 following:
line 5 (1) Revise the bylaws of the Iron Horse Corridor Management
line 6 Program Advisory Committee to include a seat for a Contra Costa
line 7 Transportation Authority representative and expand the
line 8 management program elements to include a new, seventh element
line 9 that considers proposals to study new and emerging mobility modes
line 10 and technologies in the corridor.
line 11 (2) Include a new task in the committee’s work program to
line 12 recommend a framework for acting on the proposals.
line 13 (b) The state hereby relinquishes the rights to reimbursement
line 14 established pursuant to the following California Transportation
line 15 Commission resolutions relating to the San Ramon Branch
line 16 Corridor: Resolution MT-83-16 (December 17, 1982), TP&D
line 17 Abandoned Railroad Right-of-Way Program, Resolution MT-86-1
line 18 (September 1985), TP&D Transit Capital Improvement Funding,
line 19 Resolution MT-87-2 (July 1986), and TP&D Abandoned Railroad
line 20 Right-of-Way Program.
line 21 SEC. 3. If the Commission on State Mandates determines that
line 22 this act contains costs mandated by the state, reimbursement to
line 23 local agencies and school districts for those costs shall be made
line 24 pursuant to Part 7 (commencing with Section 17500) of Division
line 25 4 of Title 2 of the Government Code.
line 26 SECTION 1. Section 75221 of the Public Resources Code is
line 27 amended to read:
line 28 75221. (a) Projects eligible for funding under the program
line 29 include, but are not limited to, all of the following:
line 30 (1) Rail capital projects, including acquisition of rail cars and
line 31 locomotives, that expand, enhance, and improve existing rail
line 32 systems and connectivity to existing and future transit systems,
line 33 including the high-speed rail system.
line 34 (2) Intercity, commuter, and urban rail projects that increase
line 35 service levels, improve reliability, or decrease travel times,
line 36 including infrastructure access payments to host railroads in lieu
line 37 of capital investments.
line 38 (3) Rail, bus, and ferry integration implementation, including,
line 39 but not limited to, integrated ticketing and scheduling systems,
6
06-10-19 TWIC Meeting Agenda
Packet Pg.47 of 192
line 1 shared-use corridors, related planning efforts, and other service
line 2 integration initiatives.
line 3 (4) Bus rapid transit and other bus and ferry transit investments
line 4 to increase ridership and reduce greenhouse gas emissions.
line 5 (b) In order to be eligible for funding under the program, a
line 6 project shall demonstrate that it will achieve a reduction in
line 7 emissions of greenhouse gases. In selecting projects for funding,
line 8 the Transportation Agency shall consider the extent to which a
line 9 project reduces emissions of greenhouse gases.
line 10 (c) The program shall have a programmatic goal of providing
line 11 at least 25 percent of available funding to projects benefiting
line 12 disadvantaged communities, consistent with the objectives of
line 13 Chapter 830 of the Statutes of 2012.
line 14 (d) In evaluating grant applications for funding, the
line 15 Transportation Agency shall consider all of the following:
line 16 (1) The cobenefits of projects that support the implementation
line 17 of sustainable communities strategies through one or more of the
line 18 following:
line 19 (A) Reducing vehicle miles traveled from automobiles and the
line 20 number of automobile trips through growth in transit ridership.
line 21 (B) Promoting housing development in the vicinity of rail
line 22 stations and major transit centers.
line 23 (C) Expanding existing rail and public transit systems.
line 24 (D) Enhancing the connectivity, integration, and coordination
line 25 of the state’s various transit systems, including, but not limited to,
line 26 regional and local transit systems and the high-speed rail system.
line 27 (E) Implementing clean vehicle technology.
line 28 (F) Promoting active transportation.
line 29 (G) Improving public health.
line 30 (2) The project priorities developed through the collaboration
line 31 of two or more rail operators and any memoranda of understanding
line 32 between state agencies and local or regional rail operators.
line 33 (3) Geographic equity.
line 34 (4) Consistency with an adopted sustainable communities
line 35 strategy or, if a sustainable strategy is not required for a region by
line 36 law, a regional plan that includes policies and programs to reduce
line 37 emissions of greenhouse gases.
line 38 (5) The extent to which a project has supplemental funding
line 39 committed to it from other nonstate sources.
line 40 (6) The extent to which the project will increase transit ridership.
7
06-10-19 TWIC Meeting Agenda
Packet Pg.48 of 192
line 1 (e) Eligible applicants under the program shall be public
line 2 agencies, including joint powers agencies, that operate or have
line 3 planning responsibility for existing or planned regularly scheduled
line 4 intercity or commuter passenger rail service, urban rail transit
line 5 service, or bus or ferry transit service.
line 6 (f) A recipient of moneys under the program may combine
line 7 funding from the program with other state funding, including, but
line 8 not limited to, the State Transportation Improvement Program, the
line 9 Low Carbon Transit Operations Program, the State Air Resources
line 10 Board clean vehicle program, and state transportation bond funds.
O
8
06-10-19 TWIC Meeting Agenda
Packet Pg.49 of 192
California
HIGH
SESSION ADJOURNMENT
September 13, 2019
102 Days Remaining
Moving Bill
Our Forecast
▼Show More
HIGH
SESSION ADJOURNMENT
September 13, 2019
102 Days Remaining
Moving Bill
Our Forecast
▼Show More
Status actions entered today are listed in bold.
File name: Master
Author:Jim Frazier (D-011)
Title:Regional Centers: Billing: Daily Rates
Fiscal
Committee:yes
Urgency
Clause:no
Introduced:01/29/2019
Disposition:Pending
Location:Assembly Appropriations Committee
Summary:Repeals the provision requiring activity centers, adult development centers, behavior
management programs, and other look-alike day programs with a daily rate to bill regional
centers for services provided to consumers in terms of 1/2 days of service and full days of
service.
Status:05/16/2019 In ASSEMBLY Committee on APPROPRIATIONS: Held in committee.
Author:Jim Frazier (D-011)
Title:Developmental Services
Fiscal
Committee:yes
Urgency
Clause:no
1.CA AB 311 Very Fast
ⓘ
2.CA AB 641 Slow
ⓘ
✔
✔
1st Committee 1st Fiscal
Committee
1st Chamber 2nd Committee 2nd Chamber Executive
1st Committee 1st Fiscal
Committee
1st Chamber 2nd Committee 2nd Chamber Executive
06-10-19 TWIC Meeting Agenda
Packet Pg.50 of 192
HIGH
SESSION ADJOURNMENT
September 13, 2019
102 Days Remaining
Moving Bill
Our Forecast
▼Show More
HIGH
SESSION ADJOURNMENT
September 13, 2019
102 Days Remaining
Introduced:02/15/2019
Last
Amend:03/21/2019
Disposition:Pending
Location:Assembly Appropriations Committee
Summary:Authorizes a consumer in a supported employment program or work activity program who has
the stated goal of integrated competitive employment in their IPP to request to use tailored day
services in conjunction with their existing program to achieve that goal, if specified criteria are
met, including that the type, amount, and provider of tailored day service allowed under these
provisions is determined through the IPP process.
Status:05/16/2019 In ASSEMBLY. Joint Rule 62(a) suspended.
05/16/2019 In ASSEMBLY Committee on APPROPRIATIONS: Held in committee.
Author:Jim Frazier (D-011)
Title:Developmental Services: Inspector General
Fiscal
Committee:yes
Urgency
Clause:no
Introduced:02/20/2019
Last
Amend:04/25/2019
Disposition:Pending
Location:Assembly Appropriations Committee
Summary:Requires the Department of Developmental Services, to convene a working group of consumers,
consumer representatives, and representatives of specified agencies to examine topics related to
oversight and accountability of the developmental services system.
Status:05/16/2019 In ASSEMBLY. Joint Rule 62(a) suspended.
05/16/2019 In ASSEMBLY Committee on APPROPRIATIONS: Held in committee.
3.CA AB 812 Fast
ⓘ
4.CA AB 823
ⓘ
✔
1st Committee 1st Fiscal
Committee
1st Chamber 2nd Committee 2nd Chamber Executive
1st Committee 1st Chamber 2nd Committee 2nd Chamber Executive
06-10-19 TWIC Meeting Agenda
Packet Pg.51 of 192
Our Forecast
▼Show More
HIGH
SESSION ADJOURNMENT
September 13, 2019
102 Days Remaining
Our Forecast
▼Show More
Author:Joaquin Arambula (D-031)
Title:Developmental Services
Fiscal
Committee:yes
Urgency
Clause:no
Introduced:02/20/2019
Disposition:Pending
Location:Assembly Human Services Committee
Summary:Includes expressly mobile crisis services and paid employment for service providers as a means
for which the Department of Developmental Services is authorized to establish guidelines for the
usage of community placement funds. Requires additionally a regional center to contract for
mobile crisis services to ensure that consumers are able to remain in the least restrictive
environment.
Status:03/04/2019 To ASSEMBLY Committee on HUMAN SERVICES.
Author:Timothy S. Grayson (D-014)
Title:Housing: Transportation Related Impact Fee Grants
Fiscal
Committee:yes
Urgency
Clause:no
Introduced:02/20/2019
Last
Amend:03/27/2019
Disposition:Pending
Location:Assembly Housing and Community Development Committee
Summary:Requires the Department of Housing and Community Development to establish a competitive
grant program to award grants to cities and counties to offset the total amount of any
transportation related impact fees exacted upon a qualifying housing development project by the
local jurisdiction.
Status:04/01/2019 Re-referred to ASSEMBLY Committee on HOUSING AND COMMUNITY
DEVELOPMENT.
ⓘ
5.CA AB 847
ⓘ
1st Committee 1st Chamber 2nd Committee 2nd Chamber Executive
95%
95%
06-10-19 TWIC Meeting Agenda
Packet Pg.52 of 192
HIGH
SESSION ADJOURNMENT
September 13, 2019
102 Days Remaining
Moving Bill
Our Forecast
▼Show More
HIGH
SESSION ADJOURNMENT
September 13, 2019
102 Days Remaining
Moving Bill
Our Forecast
▼Show More
Author:Rudy Salas (D-032)
Title:California Department Of Aging: Grants: Transportation
Fiscal
Committee:yes
Urgency
Clause:no
Introduced:02/21/2019
Last
Amend:04/12/2019
Disposition:Pending
Committee:Senate Human Services Committee
Hearing:06/10/2019 3:00 pm, Rose Ann Vuich Hearing Room (2040)
Summary:Requires the Department of Aging to administer a grant program to receive applications from
eligible applicants, including, but not limited to, area agencies on aging and public transit
operators, to fund transportation to and from nonemergency medical services for older
individuals and persons with a disability, for the purpose of reducing greenhouse gas emissions.
Status:05/29/2019 To SENATE Committees on HUMAN SERVICES and ENVIRONMENTAL QUALITY.
Author:Timothy S. Grayson (D-014)
Title:Transportation Commission: San Ramon Branch Corridor
Fiscal
Committee:yes
Urgency
Clause:
no
6.CA AB 970 Fast
ⓘ
7.CA AB 1025 Fast
ⓘ
✔✔✔
✔✔✔
1st Committee 1st Fiscal
Committee
1st Chamber 2nd Committee 2nd Chamber Executive
1st Committee 1st Fiscal
Committee
1st Chamber 2nd Committee 2nd Chamber Executive
87%
95%
06-10-19 TWIC Meeting Agenda
Packet Pg.53 of 192
HIGH
SESSION ADJOURNMENT
September 13, 2019
102 Days Remaining
Moving Bill
Our Forecast
▼Show More
HIGH
SESSION ADJOURNMENT
September 13, 2019
102 Days Remaining
Moving Bill
Introduced:02/21/2019
Last
Amend:03/26/2019
Disposition:Pending
Location:SENATE
Summary:Relinquishes the rights of the state to reimbursement for projects relating to the San Ramon
Branch Corridor. Requires the County of Contra Costa to revise the bylaws of the Iron Horse
Corridor Management Program Advisory Committee.
Status:05/23/2019 In ASSEMBLY. Read third time. Passed ASSEMBLY. *****To SENATE. (78-0)
Author:Laura Friedman (D-043)
Title:Shared Mobility Devices: Local Regulation
Fiscal
Committee:no
Urgency
Clause:no
Introduced:02/21/2019
Last
Amend:05/07/2019
Disposition:Pending
Committee:Senate Transportation Committee
Hearing:06/11/2019 1:30 pm, John L. Burton Hearing Room (4203)
Summary:Defines a shared mobility device as a bicycle, electric bicycle, motorized scooter, electrically
motorized board, or other similar personal transportation device, that is made available to the
public for shared use and transportation. Requires shared mobility devices to include a single
unique alphanumeric ID. Prohibits the sharing of individual trip data, except as provided by the
Electronic Communications Privacy Act.
Status:05/29/2019 To SENATE Committees on TRANSPORTATION and GOVERNANCE AND FINANCE
and JUDICIARY.
8.CA AB 1112 Fast
ⓘ
9.CA AB 1279 Fast
ⓘ
✔✔
1st Committee 1st Chamber 2nd Committee 2nd Chamber Executive
1st Committee 1st Fiscal
Committee
1st Chamber 2nd Committee 2nd Chamber Executive
95%
06-10-19 TWIC Meeting Agenda
Packet Pg.54 of 192
Our Forecast
▼Show More
HIGH
SESSION ADJOURNMENT
September 13, 2019
102 Days Remaining
Moving Bill
Our Forecast
▼Show More
Author:Richard Bloom (D-050)
Title:Planning and Zoning: Housing Development
Fiscal
Committee:yes
Urgency
Clause:no
Introduced:02/21/2019
Disposition:Pending
Location:SENATE
Summary:Requires the Department of Housing and Community Development to designate areas in this
state as high resource areas by January 1, 2021, and every 5 years thereafter.
Status:05/29/2019 In ASSEMBLY. Read third time. Passed ASSEMBLY. *****To SENATE. (46-20)
Author:Rebecca Bauer-Kahan (D-016)
Title:Construction Method: Transportation Projects
Fiscal
Committee:yes
Urgency
Clause:no
Introduced:02/22/2019
Last
Amend:04/12/2019
Disposition:Pending
Committee:Senate Transportation Committee
Hearing:06/11/2019 1:30 pm, John L. Burton Hearing Room (4203)
Summary:Expands the authorization to use the CM/GC project delivery method under these provisions by
expanding the definition of the term "project" to include any other transportation project that is
not on the state highway system.
Status:05/22/2019 To SENATE Committee on TRANSPORTATION.
ⓘ
10.CA AB 1475 Very Fast
ⓘ
✔✔✔
✔✔✔
1st Committee 1st Fiscal
Committee
1st Chamber 2nd Committee 2nd Chamber Executive
95%
95%
06-10-19 TWIC Meeting Agenda
Packet Pg.55 of 192
HIGH
SESSION ADJOURNMENT
September 13, 2019
102 Days Remaining
Moving Bill
Our Forecast
▼Show More
HIGH
SESSION ADJOURNMENT
September 13, 2019
102 Days Remaining
Moving Bill
Our Forecast
▼Show More
Author:David Chiu (D-017)
Title:San Francisco Bay Area: Housing Development: Financing
Fiscal
Committee:yes
Urgency
Clause:no
Introduced:02/22/2019
Last
Amend:05/16/2019
Disposition:Pending
Location:SENATE
Summary:Authorizes an entity to raise and allocate new revenue, incur and issue indebtedness, and
allocate funds to the various municipalities and affordable housing projects to finance affordable
housing development, preserve and enhance existing affordable housing, and fund tenant
protection programs.
Status:05/24/2019 In ASSEMBLY. Read third time. Passed ASSEMBLY. *****To SENATE. (45-21)
Author:Tasha Boerner Horvath (D-076)
Title:Speed Limits: City Of Encinitas
Fiscal
Committee:no
Urgency
Clause:no
Introduced:02/22/2019
Last
Amend:04/04/2019
11.CA AB 1487 Fast
ⓘ
12.CA AB 1492 Very Fast
ⓘ
✔✔✔
✔✔
1st Committee 1st Fiscal
Committee
1st Chamber 2nd Committee 2nd Chamber Executive
1st Committee 1st Chamber 2nd Committee 2nd Chamber Executive
95%
95%
06-10-19 TWIC Meeting Agenda
Packet Pg.56 of 192
HIGH
SESSION ADJOURNMENT
September 13, 2019
102 Days Remaining
Moving Bill
Our Forecast
▼Show More
HIGH
SESSION ADJOURNMENT
September 13, 2019
102 Days Remaining
Moving Bill
Our Forecast
▼Show More
Disposition:Pending
Location:Senate Transportation Committee
Summary:Authorizes the City of Encinitas to lower the speed limit to 15 miles per hour on a portion of
Neptune Avenue if that speed limit is justified by an engineering and traffic survey. Makes the 15
miles per hour speed limit effective when signs giving notice of the speed limit are posted.
Status:05/08/2019 To SENATE Committee on TRANSPORTATION.
Author:Kevin McCarty (D-007)
Title:Housing Law Compliance: State Grants
Fiscal
Committee:yes
Urgency
Clause:no
Introduced:02/22/2019
Last
Amend:04/11/2019
Disposition:Pending
Location:Assembly Appropriations Committee
Summary:Requires the Department of Housing and Community Development to review any action or failure
to act by a city or county that it determines is inconsistent with an adopted housing element or a
specified provision of the Housing Element Law. Prohibits a city or county found to be in violation
of state law from applying for a state grant, unless the eligibility of the city or county to apply is
constitutionally required or the state grant funds, if awarded to the city or county, would assist in
compliance.
Status:05/16/2019 In ASSEMBLY Committee on APPROPRIATIONS: Not heard.
13.CA AB 1568 Fast
ⓘ
14.CA SB 13 Slow
ⓘ
✔
✔✔✔
1st Committee 1st Fiscal
Committee
1st Chamber 2nd Committee 2nd Chamber Executive
1st Committee 1st Fiscal
Committee
1st Chamber
2nd Committee
2nd Chamber Executive
95%
06-10-19 TWIC Meeting Agenda
Packet Pg.57 of 192
LOW
SESSION ADJOURNMENT
September 13, 2019
102 Days Remaining
Moving Bill
Our Forecast
▼Show More
Author:Bob Wieckowski (D-010)
Title:Accessory Dwelling Units
Fiscal
Committee:yes
Urgency
Clause:no
Introduced:12/03/2018
Last
Amend:05/17/2019
Disposition:Pending
Location:ASSEMBLY
Summary:Amends the Planning and Zoning Law. Authorizes the creation of accessory dwelling units in
areas zoned to allow single family or multifamily dwelling use. Prohibits a local agency from
requiring the replacement of parking spaces if a garage, carport, or covered parking is
demolished to construct an accessory dwelling unit. Prohibits a local agency from requiring
occupancy of either the primary or the accessory dwelling unit.
Status:05/22/2019 In SENATE. Read third time. Passed SENATE. *****To ASSEMBLY. (34-2)
Author:Scott D. Wiener (D-011)
Title:Planning and Zoning: Housing Development: Incentives
Fiscal
Committee:yes
Urgency
Clause:no
Introduced:12/03/2018
Last
Amend:05/01/2019
Disposition:Pending
Location:Senate Appropriations Committee
Summary:Requires a local agency to notify the development proponent in writing if the local agency
determines that the development conflicts with any of the requirements provided for streamlined
ministerial approval. Authorizes a development proponent of a neighborhood multifamily project
located on an eligible parcel to submit an application for a streamlined, ministerial approval
process that is not subject to a conditional use permit.
Status:05/16/2019 In SENATE Committee on APPROPRIATIONS: Held in committee.
15.CA SB 50 Slow
ⓘ✔
1st Committee 1st Fiscal
Committee
1st Chamber 2nd Committee 2nd Chamber Executive
06-10-19 TWIC Meeting Agenda
Packet Pg.58 of 192
LOW
SESSION ADJOURNMENT
September 13, 2019
102 Days Remaining
Moving Bill
Our Forecast
▼Show More
LOW
SESSION ADJOURNMENT
September 13, 2019
102 Days Remaining
Moving Bill
Our Forecast
▼Show More
Author:Scott D. Wiener (D-011)
Title:Transportation Funding: Active Transportation: Streets
Fiscal
Committee:yes
Urgency
Clause:no
Introduced:01/10/2019
Last
Amend:05/17/2019
Disposition:Pending
Location:ASSEMBLY
Summary:Establishes an Active Transportation Asset Branch within the Transportation Asset Management
Office of the Department of Transportation. Requires asset management plans to prescribe
processes for community input and adopt performance measures to prioritize safety and
accessibility for pedestrians, bicyclists, and transit users in certain projects.
Status:05/23/2019 In SENATE. Read third time. Passed SENATE. *****To ASSEMBLY. (29-9)
Author:Bill Dodd (D-003)
Title:Federal Transportation Funds: State Exchange Programs
Fiscal
Committee:yes
Urgency
Clause:no
Introduced:01/15/2019
Disposition:Pending
16.CA SB 127 Slow
ⓘ
17.CA SB 137 Slow
ⓘ
✔✔✔
✔✔✔
1st Committee 1st Fiscal
Committee
1st Chamber 2nd Committee 2nd Chamber Executive
1st Committee 1st Fiscal
Committee
1st Chamber 2nd Committee 2nd Chamber Executive
13%
13%
06-10-19 TWIC Meeting Agenda
Packet Pg.59 of 192
HIGH
SESSION ADJOURNMENT
September 13, 2019
102 Days Remaining
Moving Bill
Our Forecast
▼Show More
HIGH
SESSION ADJOURNMENT
September 13, 2019
102 Days Remaining
Moving Bill
Our Forecast
▼Show More
Location:ASSEMBLY
Summary:Authorizes the Department of Transportation to allow federal transportation funds that are
allocated as local assistance to be exchanged for Road Maintenance and Rehabilitation Program
funds appropriated by the department.
Status:05/23/2019 In SENATE. Read third time. Passed SENATE. *****To ASSEMBLY. (38-0)
Author:Jim Beall (D-015)
Title:Active Transportation Program
Fiscal
Committee:yes
Urgency
Clause:no
Introduced:01/22/2019
Last
Amend:04/25/2019
Disposition:Pending
Location:Senate Appropriations Committee
Summary:Requires that a percentage of available funds be awarded to projects selected by MPOs in urban
areas with populations greater than a specified amount with the available funds distributed to
each MPO based on its relative share of the population, a percentage to fund projects in small
urban and rural regions, and a percentage to projects competitively awarded by the commission
on a statewide basis.
Status:05/16/2019 In SENATE Committee on APPROPRIATIONS: Held in committee.
Author:Hannah-Beth Jackson (D-019)
18.CA SB 152 Slow
ⓘ
19.CA SB 228 Fast
ⓘ
✔
✔✔✔
1st Committee 1st Fiscal
Committee
1st Chamber 2nd Committee 2nd Chamber Executive
1st Committee 1st Fiscal
Committee
1st Chamber 2nd Committee 2nd Chamber Executive
95%
06-10-19 TWIC Meeting Agenda
Packet Pg.60 of 192
LOW
SESSION ADJOURNMENT
September 13, 2019
102 Days Remaining
Moving Bill
Our Forecast
▼Show More
Title:Master Plan on Aging
Fiscal
Committee:yes
Urgency
Clause:no
Introduced:02/07/2019
Last
Amend:04/25/2019
Disposition:Pending
Location:ASSEMBLY
Summary:Requires the Governor to appoint a Master Plan Director and establish an Aging Task Force to
identify the policies and priorities that need to be implemented in the state to prepare for the
aging of its population. Requires the Task Force to develop a master plan with specified
components, including, among others, a proposal, with a cost estimate and an identification of
potential funding sources, for how the state should accomplish specified goals.
Status:05/23/2019 In SENATE. Read third time. Passed SENATE. *****To ASSEMBLY. (38-0)
Author:Bill Dodd (D-003)
Title:Planning and Zoning: Housing Production Report
Fiscal
Committee:yes
Urgency
Clause:no
Introduced:02/11/2019
Last
Amend:03/25/2019
Disposition:Pending
Location:Assembly Housing and Community Development Committee
Summary:Authorizes the county and the city of Napa to reach a mutually acceptable agreement to allow
one of those jurisdictions to report, on its annual production report to the Department of Housing
and Community Development, specified completed entitlements, building permits, and
certificates of occupancy issued by the other jurisdiction for the development of housing if
certain conditions are met. Requires the Napa County Board of Supervisors and Napa City
Council to hold a public hearing, as specified.
Status:05/16/2019 To ASSEMBLY Committees on HOUSING AND COMMUNITY DEVELOPMENT and
LOCAL GOVERNMENT.
20.CA SB 235 Very Fast
ⓘ✔✔✔
1st Committee 1st Fiscal
Committee
1st Chamber 2nd Committee 2nd Chamber Executive
13%
06-10-19 TWIC Meeting Agenda
Packet Pg.61 of 192
HIGH
SESSION ADJOURNMENT
September 13, 2019
102 Days Remaining
Moving Bill
Our Forecast
▼Show More
HIGH
SESSION ADJOURNMENT
September 13, 2019
102 Days Remaining
Moving Bill
Our Forecast
▼Show More
Author:Nancy Skinner (D-009)
Title:Housing Crisis Act
Fiscal
Committee:yes
Urgency
Clause:no
Introduced:02/19/2019
Last
Amend:05/21/2019
Disposition:Pending
Location:ASSEMBLY
Summary:Requires a local agency that proposes to disapprove a housing development project that
complies with applicable, objective general plan and zoning standards and criteria that were in
effect at the time the application was deemed to be complete, or to approve it on the condition
that it be developed at a lower density, to base its decision upon written findings supported by
substantial evidence on the record that specified conditions exist, and places the burden of proof
on the local agency to that effect.
Status:05/29/2019 In SENATE. Read third time. Passed SENATE. *****To ASSEMBLY. (28-7)
Author:Thomas J. Umberg (D-034)
Title:Reduction of Greenhouse Gases Emissions: Mobility
Fiscal
Committee:yes
Urgency
Clause:no
Introduced:02/20/2019
21.CA SB 330 Fast
ⓘ
22.CA SB 400 Fast
ⓘ
✔✔✔
✔✔✔
1st Committee 1st Fiscal
Committee
1st Chamber 2nd Committee 2nd Chamber Executive
1st Committee 1st Fiscal
Committee
1st Chamber 2nd Committee 2nd Chamber Executive
95%
95%
06-10-19 TWIC Meeting Agenda
Packet Pg.62 of 192
HIGH
SESSION ADJOURNMENT
September 13, 2019
102 Days Remaining
Moving Bill
Our Forecast
▼Show More
Disposition:Pending
Location:Assembly Transportation Committee
Summary:Provides that the term mobility option also includes bike sharing and electric bicycles under the
Clean Cars 4 All Program.
Status:05/30/2019 To ASSEMBLY Committee on TRANSPORTATION.
Author:Ben Allen (D-026)
Title:Regional Transportation Plans: Greenhouse Gas Emissions
Fiscal
Committee:yes
Urgency
Clause:no
Introduced:02/21/2019
Last
Amend:04/30/2019
Disposition:Pending
Location:Senate Appropriations Committee
Summary:Requires the State Board of Air Resources to adopt a regulation that requires a metropolitan
planning organization to provide any data that the Board determines is necessary to fulfill the
requirements of a specified report and to determine if the metropolitan planning organization is
on track to meet its greenhouse gas emission reduction target deadline. Establishes an
interagency working group to develop and implement a State Mobility Action Plan for Healthy
Communities.
Status:05/16/2019 In SENATE Committee on APPROPRIATIONS: To Suspense File.
05/16/2019 In SENATE Committee on APPROPRIATIONS: Held in committee.
23.CA SB 526 Very Fast
ⓘ✔
1st Committee 1st Fiscal
Committee
1st Chamber 2nd Committee 2nd Chamber Executive
06-10-19 TWIC Meeting Agenda
Packet Pg.63 of 192
Smith, Watts & Hartmann , LLC.
Consulting and Governmental Relations
980 Ninth Street, Suite 2000 Sacramento, CA 95814
Telephone: (916) 446-5508 Fax: (916) 266-4580
June 4, 2018
MEMORANDUM
TO: JOHN CUNNINGHAM
FROM: MARK WATTS
SUBJECT: LEGISLATIVE REPORT – JUNE 2018
The following is a brief overview of activities undertaken in the Capitol recently.
State Legislature
Legislative Deadlines. May 31 was the deadline for regular bills introduced since the Session
began to successively pass out of their initial house to the second house; bills that do not meet
this deadline, for the most part, will be held over as “two -year” bills, with the anticipation that
they will face a requirement that they move through the house of origin in January, 2020.
Many of the bills that succeeded in surpassing this deadline have received their referrals to the
opposite house committees for assignment and hearing.
State Budget. Additionally, the budget deliberations have moved from the point wherein each
house has just adopted their version of the revisions to the Governor’s budget spending plan
proposal for 2019-20 and the discussions move on to the conference committee to reconci le
differences between the spending plans; the objective is to complete the conference committee
deliberation in time to have each house approve the final State Budget plan for the Governor’s
approval by June 15th.
This week the Conference committee addressed an initial “pass” through the Resources and
Transportation budget items. The differences in Transportation items are very limited this year as
the two houses adopted most of what the Governor had requested (a short summary of key items
follows):
Overview of Transportation budget Items (not in conference):
2019-20 Transportation Budget Items adopted by both houses:
- $2.0 billion in Road Maintenance and Rehabilitation Account (RMRA) funding for local
and capital funding for transportation projects consistent with SB 1. The request included position
authority for 333 Maintenance and 13 new permanent Equipment Program positions. The
Caltrans support request includes $28.8 million ongoing resources and $26.8 million limited -term
resources.
06-10-19 TWIC Meeting Agenda
Packet Pg.64 of 192
2
- Approved the Capital Outlay Support program budget of $1.9 billion. This includes
funding for the full time equivalent of 10,353.8 positions. Of this amount, 8,886.6 are Caltrans full
time equivalent positions ($1.5 billion), 441.4 full time equivalent positions for c ash overtime ($53
million), and 1,031.8 full time equivalent positions for contracting out for Architectural and
Engineering services ($266.2 million).
- Approved $85.5 million for Project Initiation Documents (PIDs) for 429.4 positions and
the equivalent of 20 full time positions for 5 percent of funding for contracting out for A&E
services.
- Approved $828,000 State Highway Account funds and an overall increase of 10 positions
for the Office of the Inspector General (OIG). Also, transfers resources from e xisting Caltrans’ audit
programs to the OIG. Finally, adopts trailer bill language that clarifies the OIG’s authority.
Legislation of Local Note
AB 1025 (Grayson) – Sponsored by Contra Costa County (Transportation, Water & Infrastructure
Committee – TWIC), the bill was approved by both Assembly Transportation and Appropriations
committees and is pending approval on the Assembly Floor. The measure eliminates a state grant
repayment requirement that is at least 35 years old, related to the former SP Rail li ne that was
abandoned by SP in the late 70s.
Status: In Senate pending referral to committee
AB 1475 (Bauer -Kahan) – The Authority is sponsor of this bill; as recently amended, it authorizes
the use of the Construction Manager/General Contractor (CMGC) project development procedure
for use by Regional Transportation Agencies (RTAs) across the state in aiding local city/county
projects within their own jurisdiction. The bill has passed the Assembly and is pending referral to
committee in the Senate.
Status: Set for hearing on June 11 in Senate Transportation
Legislation of Interest
AB 1413 (Gloria) - Sub-county Tax Jurisdiction –This bill authorizes a local transportation authority
to impose a sales tax that’s applicable to only a portion of its count y; revenues derived from this
sales tax must be spent within the designated portion of the county. The measure is pending
approval on the Assembly floor.
Status: Referred to Senate Transportation and Governance & Finance committees
ACA 1 (Aguiar-curry) – Proposes to amend the California Constitution, subject to approval by
voters at a statewide election, to allow a city, county, or special district, with 55% voter approval,
to incur bonded indebtedness or impose specified special taxes to fund projects f or affordable
housing, permanent supportive housing, or public infrastructure .
Status: Assembly Floor
06-10-19 TWIC Meeting Agenda
Packet Pg.65 of 192
3
Housing and Transportation Legislation
AB 1568 (McCarty) – Originally this bill would have denied SB 1 Local Road funds to a city or
county that failed to make progress in meeting housing production goals. The bill has been
amended to replace the SB 1 restriction with a prohibition on applying for state grants if a city or
county is not in compliance with the Housing Element Law; the exclusion would not apply if the
grant funds in question were transportation funds.
Status: The bill was approved by the Assembly Housing and community a Development
committee on April 24 but, later retained on the Appropriations Suspense File.
Newsom Administration
The Administration has moved ahead with a series of new appointments to key positions in the
transportation hierarchy. First, as reported earlier, Secretary Brian Annis has accepted a position
as CFO for the High-Speed Rail Authority; he began his work there t his week. The new Secretary of
Transportation is David Kim who will assume his position in early July.
The Governor also recently appointed Elissa Konove as Transportation Undersecretary, to replace
Christine Inouye, who has accepted a position as Chief of Engineering at the High-speed Rail
Authority. Konove, like David Kim, comes to California with substantial career experience in
federal transportation agencies. Most recently she was part of the executive team at Southern
California’s regional rail system, Metrolink.
At Caltrans, just this past week, Director Laurie Berman announced her intent to retire after 36
years of service. No replacement has been announced yet.
Finally, there remain two vacancies out of the eleven commissioner slots at the Calif ornia
Transportation commission that are anticipated to be filled so
06-10-19 TWIC Meeting Agenda
Packet Pg.66 of 192
TRANSPORTATION, WATER &
INFRASTRUCTURE COMMITTEE 8.
Meeting Date:06/10/2019
Subject:RECEIVE report, DISCUSS County priorities for CCTA's 2020
Transportation Expenditure Plan (TEP)/Sales Tax and DIRECT staff as
appropriate.
Submitted For: John Kopchik, Director, Conservation & Development Department
Department:Conservation & Development
Referral No.: 3
Referral Name: Monitor the Contra Costa Transportation Authority including efforts to
implement Measure J
Presenter: John Cunningham, DCD Contact: John Cunningham
(925)674-7833
Referral History:
The Contra Costa Transportation Authority's (CCTA's) effort to bring a sales tax/transportation
expenditure plan (TEP) to the ballot in 2020 has not been taken up by the Transportation, Water,
and Infrastructure Committee (TWIC). The full Board of Supervisors discussed the item at their
May 21, 2019 meeting, and directed staff to use the 2016 Measure X TEP and the County's
priorities for that effort to guide input for the current 2020 effort.
Staff has developed input based on that direction and is bringing it to TWIC for discussion,
refinement, and further direction including how to communicate the County's position to CCTA.
Referral Update:
[Staff Note: As this agenda was being posted, CCTA posted an Authority Board Special TEP
Meeting Agenda. Given the time constraints this process is operating under, the CCTA packet in
its entirety is attached to accomodate a complete discussion.]
Listed below are 1) the County's priorities/input for the 2016 Measure X and how those priorities
were ultimately reflected in the Measure, and 2) Those priorities updated for the 2020 effort.
Categories include Local Road Funding Needs, Transit Service Improvements, Improved Land
Use Coordination/Community Development Transportation Program, and an expanded, improved
Safe Routes to School Program.
Local Road Funding Needs ("Local Streets Maintenance & Improvements" in Measure J, aka
"return-to-source")
2016 Measure X: The BOS supported the recommendations of each Regional Transportation Planning
06-10-19 TWIC Meeting Agenda
Packet Pg.67 of 192
Committee (RTPCs): SWAT: 25%-30%, TRANSPAC: 30%, TRANSPLAN: 30%, WCCTAC: 28%. The
BOS cited increasing complete streets and storm water design requirements in their argument for increased
funding.
Ultimately, the Measure X TEP had 23.79% for this program.
2020 TEP Update/Recommendation: RTPC recommendations are not yet consistently available.
However, the Contra Costa County Public Managers have communicated a preference for 24%.
Discussion : The passage of Senate Bill 1(2017 - various gas tax increases), which increased gas tax
revenue for local jurisdictions, has been cited as an reason to reduce the funding levels for this program.
Counter argument: 1) SB 1 did not completely address the substantial shortfall, and 2) as evidenced by
CCTA's polling and observing the relevant policy framework (complete streets, vision zero, active
transportation) there is a growing need for "first mile/last mile" connections and active transportation
projects. These are inherently local projects requiring increases in local funding.
Transit Service Improvements:
2016 Measure X
Accessible Transit: The County successfully advocated for additional funding and "fundamental
administrative" changes to be addressed in the TEP.
Ultimately this program was funded at 4% and required the Accessible
Transportation Strategic (ATS) Plan be conducted (which is currently underway).
Fixed Route/Conventional Transit: The County's letter cited the recent (at that time) passage
of SB 743 (2013, Transition from Level of Service [LOS] to Vehicle Miles Traveled[VMT]) and
speculation that transit service would be a critical mitigation measure in this new environmental review
paradigm.
Ultimately, Measure X included the following program category, "Improving our
BART, Bus, Ferry and Train Networks" funded at 26.79%. This category
included 5 sub-programs targeting different types/locations of transit service.
2020 TEP Update/Recommendation
Accessible Transit: Given that the ATS Plan is underway, and it had its origins in the 2016
Measure X process, the 2020 TEP could reference the existing planning process and commit to funding
the recommendations.
Discussion : During the process to initiate the ATS Plan staff conducted a substantial amount of
outreach to gather feedback and secure commitments for collaboration. Staff witnessed a considerable
amount of resistance and tension relative to the effort. A successful ATS Plan is critical for the 2020
TEP to result in material improvements to accessible transit systems.
Fixed Route/Conventional Transit: Again, CCTA polling indicated an interest in increased
travel options and "first mile, last mile" connections. The public transit system, as it evolves in
response to various pressures, should be well-positioned to provide these connections.
Discussion : In addition to the rationale above, pressures from AB32, SB375, SB743 are only
increasing. These legislative initiatives, focused on greenhouse gas and vehicle miles traveled
reduction, increase the need for for improved/expanded public transit. This need comes at a time when
transit districts are reducing service and facing operational challenges.
Improved Land Use Coordination/Community Development Transportation Program
(CDTP): This would be a new program, Measure J does not have an equivalent program. The CDTP would
focus on "making more efficient use of our transportation infrastructure". Put more directly, the goal was to
incentivize land use changes that would result in the surplus, off-peak transportation capacity being used.
Co-benefits would be increased local jobs and housing.
06-10-19 TWIC Meeting Agenda
Packet Pg.68 of 192
Co-benefits would be increased local jobs and housing.
2016 Measure X: Ultimately, the BOS proposal "Improved Land Use Coordination" resulted in the
"Community Development Transportation Program" being included in the TEP. That program description
can be seen in the attached 2016 TEP.
2020 TEP Recommendation: Conservation and Development staff have marked up the 2016 Measure
X "Community Development Transportation Program" which is attached for review/discussion.
Discussion : Since the 2016 Measure X effort the housing crisis has grown much more acute with the need
for infill and affordable units also increasing. The off-peak (reverse) commute capacity remains an
underutilized investment.
Safe Routes to School (SR2S) Program: As mentioned during the 5-21 Board discussion, this concept did
not get much traction during the Measure X effort.
2016 Measure X: The County's proposal was to capitalize on a "Safe Routes to School Master Plan"
conducted by CCTA and implement a comprehensive effort to increase the bike/walk rate for students during
the home/school/home trip. At the time, the State had recently adopted a formal Bicycle and Pedestrian
Safety Curriculum, the proposal was to work with the school districts to consistently implement the
curriculum on a consistent, countywide basis.
Ultimately, Measure X included a conventional SR2S program funded at %2.23.
2020 TEP Recommendation: Staff believes that the concept continues to be valid.
Discussion : SR2S programs have been in existence for approximately 20 years. These programs are
typically grant funded and support both ongoing programs and activities in response to specific opportunities
and catastrophic events. The proposal is for a more proactive, systematic program.
In summary the program would: 1) systematically examine all 285 public K-12 schools in the County,
determine what the capital and programmatic needs are at each site and fund implementation, and 2) fund the
implementation of the states adopted bicycle/pedestrian curriculum in cooperation the 19 school districts in
the County. A substantial amount of the research and data collection was already done as a part of CCTA's
SR2S Masterplan which never moved to an implementation phase. A new TEP could leveraging the existing
work and fund that phase.
Recommendation(s)/Next Step(s):
RECEIVE report, DISCUSS County priorities for the Contra Costa Transportation Authority's
2020 Transportation Expenditure Plan/Sales Tax and DIRECT staff as appropriate.
Fiscal Impact (if any):
None.
Attachments
2016 Measure X: CDTP - Revised DRAFT
2016 MeasX TEP
CCTA 6-4-19 TEP Special Meeting
History
Suggested Language
06-10-19 TWIC Meeting Agenda
Packet Pg.69 of 192
Community Development Transportation Program $100 million
ThisIn order to provide more places for Contra Costa County residents to work closer to where
they live, improve their commute options, and have a better quality of life, this category is
intended to provide funding to implement a new Community Development Transportation
Program (CDTP) to be administered by the Authority in conjunction with the Authority’s
existing Transportation for Livable Communities Program (TLC) with projects identified by the
Authority’s Regional Transportation Planning Committees (RTPCs). Funds No less than half the
funds in this program will be allocated by the Authority on a competitive basis to transportation
capital projects or programs that promote housing within planned or established centers that are
supported by transit, or that support economic development and job creation sustain existing and
new jobs in Contra Costa County. All projects The remainder of funds will be selected
throughallocated by the Authority on a competitive project selection process within each
subregion with the Authority approving the final program of projects, allowing for a
comprehensive countywide approach while recognizing subregional needsbasis to achieve the
overall program goal. Project sponsors must demonstrate that at least 20 percent of the project is
funded from other than local transportation sales tax revenue. Additional priority will be
givencapital projects that that promote access to projects where the sponsor can demonstrate that
the project supports and facilitates development of jobs affordable infill housing. The funds
must be spent on infrastructure (on- or off-site) that directly improve multimodal access to the
employment or housing for all income levelssite(s). Examples of potentially eligible use of funds
(for illustrative purposes only) include new or upgraded rail crossings to “unlock” development
potential, freight rail improvements, multilevel or underground parking structures, bike lanes and
that have additional matching funds that have already been committed or secured. Working with
the RTPCs, the Authority will prepare guidelinesbike facilities in industrial parks and establish
overallon routes from transit stations to industrial areas or other underserved areas.
All projects will be selected through a competitive process, either within each subregion with the
Authority approving the final program of projects, or by the Authority for projects of countywide
significance, allowing for a comprehensive approach while recognizing subregional needs to
achieve the overall program goal – improved jobs-housing balance in Contra Costa County.
Project sponsors must demonstrate that at least 20 percent of the project costs are funded from
non-local transportation sales tax revenue; unless sponsor demonstrates the project is of regional
significance by its inclusion in regional plans and/or support from agencies in other subregions.
Additional priority will be given to projects that create new employment opportunities along the
Highway 4 corridor, in order to decrease congestion and commute times and use the counter-
commute transit capacity, and to housing and jobs projects located in jurisdictions that have met
at least a pro-rata portion of their RHNA targets, and are compliant with annual Housing
Element reporting requirements as determined by the State of California.
Working with the RTPCs, the Authority will prepare guidelines and establish overall criteria for
the program with the intent of complementing and administering the program in conjunction
with the Authority’s Measure J TLC program no later than December 31, 2017.20XX.
06-10-19 TWIC Meeting Agenda
Packet Pg.70 of 192
2016
Transforming Contra Costa County
Our New 30-Year Transportation Expenditure Plan
06-10-19 TWIC Meeting Agenda
Packet Pg.71 of 192
Table of Contents
Transforming Contra Costa County 3
Plan Summary 4
The Plan for Contra Costa’s Future 6
Policy Statements 36
Taxpayer Safeguards and Accountability 48
06-10-19 TWIC Meeting Agenda
Packet Pg.72 of 192
3ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
Contra Costa is a county as unique and diverse as its
residents. Our communities stretch from the Richmond
coastline to Discovery Bay, from Port Chicago to the San
Ramon Valley, and from Mount Diablo to Crocket Hills. We
are growing with the times while protecting the qualities that
make Contra Costa County a wonderful place to call home.
9GPGGFCVTCPURQTVCVKQPRNCPVJCVTGƃGEVUYJGTGYGCTG
PQY CPF OQTG KORQTVCPVN[ QWT EQOOKVOGPV VQ RWTUWG
VTCPURQTVCVKQPRQNKEKGURNCPPKPICPFKPXGUVOGPVUVJCVYKNN
IGVWUYJGTGYGYCPVVQDG
The Contra Costa Transportation Authority (CCTA) is
responsible for maintaining and improving the county’s
transportation system by planning, funding, and delivering
critical transportation infrastructure projects and programs that
connect our communities, foster a strong economy, increase
ÃÕÃÌ>>LÌÞ]>`Ã>viÞ>`ivwViÌÞ}iÌ«i«i>`vÀi} Ì
where they need to go. CCTA is also the county’s designated
Congestion Management Agency (CMA), responsible for
«ÕÌÌ}«À}À>ë>ViÌii«ÌÀ>vwViÛiÃ>>}i>Li°
ÕÀÀiÌÞ] ÕÀ ÌÀ>ëÀÌ>Ì ii`à Ã}wV>ÌÞ iÝVii`
available revenue to meet those needs. Over the next 30 years,
our population will continue to grow and that population will
have new and additional needs. A new countywide funding
measure and Transportation Expenditure Plan (TEP) can keep
Contra Costa County moving and create the livable and
sustainable communities that all Contra Costans deserve.
After extensive public engagement and analysis, CCTA
prepared a 30-year TEP that will RTQOQVGCUVTQPIGEQPQO[
RTQVGEV VJG GPXKTQPOGPV OCKPVCKP CPF KORTQXG NQECN
UVTGGVU CPF TQCFU GPEQWTCIG ITGCVGT VTCPUKV WUCIG CPF
CNVGTPCVGHQTOUQHVTCPURQTVCVKQPCPFGPJCPEGVJGSWCNKV[
of life for all of Contra Costa’s diverse communities. This new
/
*ÜLiiwÌiÛiÀÞ«iÀÃ>`iÛiÀÞ«>ÀÌvÌ iVÕÌÞ°
This plan is transformative on every level. With a strong focus
on technology and innovation, the plan will deliver COQTG
GHƂEKGPVENGCPGTCPFHCUVGTVTCPURQTVCVKQPU[UVGO
/ i iÜ «> Ü Ã}wV>ÌÞ VÕÌ iÃÃÃ Ì ÀÕ} >
emphasis on transit, electric and other non-fossil fuel oriented
modes of transportation and transportation networks. It
provides for new BART cars that will reduce energy use,
pollution and costs, and that will provide increased frequency
of BART trains and improved BART station access, and also
provides for improved bus transit operations and improved
bus frequency, potential driverless vehicles, bikes in every
community, and connectivity among and with all modes of
transportation.
The plan also sets forward clear policies that ensure that while
we grow, we will keep all growth within clear urban limit lines.
This will allow the county to continue growing in a smart way,
while protecting vital open space for parks and farmland.
Furthermore, increased investments in bike and pedestrian
paths and walkways bring access to the outdoors to every
community.
Smooth, safe and complete streets for cars, trucks, buses,
bikes and pedestrians, along with extraordinary investments
in direct funding to Contra Costa’s communities for local
street and road repair, will greatly enhance all communities.
For our urban areas, the plan focuses on support for transit
and transit-oriented mixed-use development. This includes an
emphasis on bicycle and pedestrian opportunities,
ÌiÀViVÌÛÌÞ]ÌÀ>ÃÌ]ÌÀ>vwVÃÌ }]>`ÌiV }V>
>`Û>ViÃÌiÃÕÀiÕÀÃÞÃÌiÃ>ÀiivwViÌ>`ÜÀÜi
together.
/ ë>ÜLiiwÌÌ i«i«iÜ Ûi
ÌÀ>
ÃÌ>
County by:
• #VVTCEVKPIOQTGIQQFLQDU, which will reduce
commute trips and congestion
• #EVKXGN[OCPCIKPIVJGKORCEVUQHITQYVJ on our
community so we support local businesses and
preserve our environment
• #EEQOOQFCVKPIVJGPGGFUQHCNN transportation
modes, while increasing the use of alternative
transportation; and
• 'PJCPEKPIVTCPURQTVCVKQPUGTXKEGU for seniors,
persons with disabilities and school children
This TEP was developed with two key documents as
guidance – the Expenditure Plan Advisory Committee (EPAC)
Vision, Goals and Objectives and the CCTA Principles for
Development of a Transportation Expenditure Plan. Both
documents are available for review at www.CCTA.net. Building
on these two documents and extensive public engagement
with stakeholders, the TEP articulates how the Authority will
use nearly $3 billion in additional revenue to invest wisely
– using locally-generated funds and leveraging outside
>ÌV } vÕ`Ã q Ì >Ýâi Ì i LiiwÌÃ vÀ >
ÌÀ>
Costa residents by promoting a strong economy, protecting
the environment, maintaining and improving local streets and
roads, and encouraging greater transit usage and alternate
forms of transportation.
Transforming Contra Costa County
06-10-19 TWIC Meeting Agenda
Packet Pg.73 of 192
4 ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
! "# ( "% ,
% ) % % !.1 !/ @
& % +%!+ )
"' !;;4 6:-;=@
$ '.0 . "&'% "&&"% "
!$%#+!"'&;88 981<<D
*&%"& '"' %
#"3 %"& '" "!"'&:A= 981:>D
&'#"'%#&'%"& '-'"& #"?8 :1<<D
$ '.%"& '
!$%#+!"'& #"'
3@8#%% #%== 91A9D
"'% '. "%%.%+
!$%#+!"'&=8 91?<D
% !#
" 9=9 64-;5@
% #,
!$%#+!"'&" $ '.%"& '
!$ !"'(#" #"
3>@8":<:=8 @1?8D
&'#*"'.#%% #%4&##"2#%.%#" ,.#%% #%&5
!$%#+!"'&99? <18?D
% #,
!$%#+!"'& #":<:"<98@ ;1?;D
3@8
"'% "
!$%#+!"'&'" #!#""'% +>8 :18AD
3>@8"<
"'% "
!$%#+!"'&>8 :18AD
(
" "! !:<8 67-;=@
# '%' "'"""
!$%#+!"'&>@< :;1?AD
&
! "# +
!+ '"!#!5;= :-67@
%"&$#%'(#"#% %">< :1:;D
%"&$#%'(#"#%" #%&"#$ , ' & (&99= <188D
%
%!" % #! "# " & ":76 65-=<@
#%'%'&"#!$ ''%'&%# '%"'&:A8 9818AD
&'% "0 . "% (&99= <188D
#!!*" '.+ #$!"'%"&$#%'(#"%#%!988 ;1<@D
""#+(+%"&$#%'(#" "# # &2#""'#!!*" (&%"'%#%!>= :1:>D
%"&$#%'(#" "" "0 (&"%+ &<; 91=8D
#" %"&$#%'(#"% #% (&9A 81>=D
" &!" "!:@>8 AA1=8D
! " &'%(#"9< 81=8D
#' #&':@?< 98818D
Cost in 2016 Dollars
For the full breakdown see the chart on page 56.
Transportation Expenditure Plan Summary
06-10-19 TWIC Meeting Agenda
Packet Pg.74 of 192
5ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
See Appendix A on page 56 for detailed distribution of funding by subregion.
Transportation Expenditure Plan Summary by Category
6.2%
Providing
Affordable and Safe
Transportation for
Children, Seniors, and
People with Disabilites
23.8%
Fixing Local Streets
and Roads
22.0%
Building Sustainable
Communities and
Protecting the
Environment 26.8%
Improving our BART, Bus,
Ferry and Train Networks
20.7%
Reducing Congestion
>`-Ì }/À>vwV
0.5%
Administration
Transportation Expenditure Plan Summary by Region
Central
29.4%
East
28.2%
Southwest
19.1%
West
23.3%
06-10-19 TWIC Meeting Agenda
Packet Pg.75 of 192
6 ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
The Plan for Contra Costa’s Future
06-10-19 TWIC Meeting Agenda
Packet Pg.76 of 192
7ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
06-10-19 TWIC Meeting Agenda
Packet Pg.77 of 192
Improving our BART, Bus,
Ferry and Train Networks
26.8%
06-10-19 TWIC Meeting Agenda
Packet Pg.78 of 192
9
Reduces Congestion
Reduces Greenhouse Gas Emissions
Improves BART Service
Improves Bus Service
Expands Bicycle Access/Improves Bicycle Safety
Improves Pedestrian Safety
Improves Transportation Connectivity
Provides Alternatives to Single-Occupant Vehicle Use
Integrates New Technology
Creates Good Local Jobs
i
$GPGƂVU-G[
>V VÀi«ÀiÃiÌÃ>LiiwÌÌ
ÌÀ>
ÃÌ>
ÕÌÞ>Ã>ÀiÃÕÌvÌ i«ÀÌvÌ i
plan being described.
06-10-19 TWIC Meeting Agenda
Packet Pg.79 of 192
10 ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
Improving Our BART, Bus, Ferry and Train Networks
This category is intended to provide funding to increase
the capacity of and ridership on the BART System in
Contra Costa County, including improvements to local
BART stations, as well as access and parking in Contra
Costa County. Funds in this category are intended to be
allocated by the Authority for the acquisition of additional
new BART cars, provided that: 1) BART agrees to fund a
minimum of $100 million in BART station, access and
parking improvements in Contra Costa County from other
BART revenues, and 2) a regional approach, that includes
commitments of equal funding shares from both Alameda
and San Francisco counties and additional regional funding
from the Metropolitan Transportation Commission, is
developed and approved no later than December 31, 2024.
BART station, access and parking improvements or alternate
public transit services that access BART may include
station capacity, safety and operational improvements;
infrastructure improvements that facilitate Transit Oriented
Development at or near BART stations; additional on or
off site parking, last mile shuttle or shared vehicles that
provide alternatives to driving single-occupant vehicles
to BART stations; and bicycle/pedestrian facilities that
provide access to BART stations.
In the event that commitments from the four parties to fund
additional BART cars are not approved by December 31,
2024, or any date earlier if BART informs the Authority it
is no longer pursuing the acquisition of additional BART
cars as provided herein, and if BART has maintained
the commitment to fund a minimum of $100 million in
improvements as described above, the Authority (in
consultation with the RTPCs) and BART will jointly identify,
and the Authority will allocate these funds for other capacity-
i >V}] Ã>viÌÞ >` ivwViVÞ VÀi>Ã} «ÀiVÌÃ Ì
include station, access and parking improvements or
alternate public transit services that access BART) that
LiiwÌÌ iÀiÃ`iÌÃv
ÌÀ>
ÃÌ>
ÕÌÞ°
Prior to the allocation of funds to BART, the Authority
>À` Ã > >i > w`} Ì >Ì Ƃ,/ >Ã VÃÃÌiÌÞ
maintained its commitment to use a proportional share of
ÌÃy>ÌL>Ãi`v>ÀiVÀi>Ãi]À>iµÕÛ>iÌ>ÕÌ]
vÀV>«Ì>«ÀiVÌÃ>Ã`iwi`LÞ Ƃ,/½Ã,iÃÕÌ °
5208 passed in February 2013. In years where BART
fare revenues are reduced by a decrease in ridership or
unforeseen economic circumstances, or where one-time
costs are increased by a natural disaster, then the Authority
>ÞÀii>ÃivÕ`ÃvÌ iƂÕÌ ÀÌÞ >À`>iÃw`}Ã
that 1) BART has not reduced its capital project funding
disproportionately and 2) BART made best efforts to fund
V>«Ì>«ÀiVÌÃÌ >ÌLiiwÌ
ÌÀ>
ÃÌ>
ÕÌÞ°
BART Capacity, Access and Parking Improvements $300 Million
i
Improving Our BART, Bus, Ferry and Train Networks
06-10-19 TWIC Meeting Agenda
Packet Pg.80 of 192
11ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
Improving Our BART, Bus, Ferry and Train Networks
Bus Transit and Other Non-Rail Transit Enhancements OKNNKQn
$WU6TCPUKV'PJCPEGOGPVUKPVJG9GUV
5WDTGIKQPQH%QPVTC%QUVC OKNNKQP
This subcategory is intended to provide funding for
public transit operators to maintain and increase transit
operations, including any transit capital expenses and/
or operating expenses for existing service or service
improvements/enhancements in the West subregion
of Contra Costa. Funding is to provide for bus transit
operations to increase or maintain ridership, including
incentivizing transit use by offsetting fares, and improve
the frequency and capacity of routes, especially high
demand routes. Funding will be allocated by the Authority
based on input from the WCCTAC in consultation with
local bus operators and stakeholders.
$WU6TCPUKV'PJCPEGOGPVUCPF1VJGT0QP4CKN
6TCPUKV'PJCPEGOGPVUKPVJG%GPVTCN'CUVCPF
5QWVJYGUV5WDTGIKQPUQH%QPVTC%QUVC OKNNKQP
This subcategory is intended to provide funding for public
transit operators to maintain and increase transit operations,
including any transit capital expenses and/or operating
expenses for existing service or service improvements/
enhancements, and also to provide funding for future
non-rail transit service alternatives in the Central, East and
Southwest subregions of Contra Costa. Funding is to provide
for bus transit operations to increase or maintain ridership,
including incentivizing transit use by offsetting fares, and
improve the frequency and capacity of routes, especially high
demand routes. Funding will be allocated by the Authority
for the Central, East and Southwest subregions of Contra
Costa based on input from the RTPCs in those subregions,
in consultation with local bus operators and stakeholders.
Funding allocation by the Authority may include use of a
portion of the funds for non-rail transit services/projects
that demonstrate an innovative approach to maximize the
ÛiiÌv«i«iivwViÌÞ>`>>iÀÌ >ÌÀi`ÕViÃ
Vehicle Miles Traveled (VMT) and Green-house Gas (GHG).
i
Improving Our BART, Bus, Ferry and Train NetworksImproving Our BART, Bus, Ferry and Train Networks
06-10-19 TWIC Meeting Agenda
Packet Pg.81 of 192
12 ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
Improving Our BART, Bus, Ferry and Train Networks
East Contra Costa Transit Extension (BART or alternative) OKNNKQP
This category is intended to provide funding to improve
access to and extend high capacity transit service easterly
from the Hillcrest BART Station in Antioch through Oakley
to a new transit station in Brentwood. To the greatest
degree possible, local funds generated by this measure
shall be used to leverage additional regional, state and/
or federal funds for this project. Funds from this category
may be used to complete an interim transit station in
Brentwood.
i
High Capacity Transit Improvements along
the I-80 Corridor in West Contra Costa County OKNNKQP
This category is intended to fund projects/programs for
high capacity transit improvements along the I-80 corridor.
Final determination on the scope of the improvements to
LiVÃÌÀÕVÌi`ÜLiL>Ãi`Ì iw>ÀiVi`>ÌÃ
in the West County High Capacity Transit Study and in
consultation with the west subregion. To the greatest
degree possible, local funds generated by this measure
shall be used to leverage additional regional, state and/or
federal funds for this project.
i
06-10-19 TWIC Meeting Agenda
Packet Pg.82 of 192
13ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
Improving Our BART, Bus, Ferry and Train Networks
This category is intended to provide funding to construct
station and/or track improvements to the Capitol Corridor
and/or the San Joaquin corridors, as well as to implement
new or improved ferry services (including both capital
and operations) in Richmond, Hercules, Martinez and/or
Antioch. Projects that increase ridership using existing
capacity, including incentivizing use by offsetting fares
or other methodologies, may also be considered. To the
greatest degree possible, local funds generated by this
measure shall be used to leverage additional regional,
state and/or federal funds for this project. Any projects
funded in this category will be evaluated by the Authority
and demonstrate progress toward the Authority’s goals of
reducing Vehicle Miles Traveled (VMT) and green-house
}>à ® Ài`ÕVÌð -iiVÌ v w> «ÀiVÌÃ Ì Li
based on a performance analysis of project alternatives
consistent with Authority requirements. Sponsors of
projects requesting funding from this category will be
ÀiµÕÀi`Ì`iÃÌÀ>ÌiÌÌ iƂÕÌ ÀÌÞÌ >ÌÃÕvwViÌ
funding is available to operate the proposed project and/
or service over a long period of time.
Intercity Rail and Ferries OKNNKQP
i
06-10-19 TWIC Meeting Agenda
Packet Pg.83 of 192
14 ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
Reducing Congestion
>`-Ì }/À>vwV
20.7%
06-10-19 TWIC Meeting Agenda
Packet Pg.84 of 192
15
Reduces Congestion
Reduces Greenhouse Gas Emissions
Improves BART Service
Improves Bus Service
Expands Bicycle Access/Improves Bicycle Safety
Improves Pedestrian Safety
Improves Transportation Connectivity
Provides Alternatives to Single-Occupant Vehicle Use
Integrates New Technology
Creates Good Local Jobs
i
$GPGƂVU-G[
>V VÀi«ÀiÃiÌÃ>LiiwÌÌ
ÌÀ>
ÃÌ>
ÕÌÞ>Ã>ÀiÃÕÌvÌ i«ÀÌvÌ i
plan being described.
06-10-19 TWIC Meeting Agenda
Packet Pg.85 of 192
16 ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
/À>vwVÜ«ÀÛiiÌÃ>`}
>«>VÌÞOKNNKQP
Transit Implementation Along I-680 and SR 24
,i`ÕV}
}iÃÌ>`-Ì }/À>vwV
This category is intended to fund an I-680 corridor express
lane and operational improvement project to facilitate
carpools and increase transit use in the corridors as an
alternative to single occupant vehicle travel. Funding
may also be used to implement high capacity transit
«ÀÛiiÌÃÌ iVÀÀ`ÀVÕ`}Ì Ãi`iÌwi`
in the I-680 Transit Investment and Congestion Relief
Options and other relevant studies). Funding may also be
used to complete improvements to the mainline freeway
and/or local interchanges along I-680 and SR 24 as may be
required to implement express lane and/or transit projects
>ÃÜi>Ã>`Û>Vi`ÌÀ>vwV>>}iiÌ«À}À>Ã>`É
or other projects or programs that encourage the use of
connected vehicle and/or autonomous vehicles in the
corridor provided that the project sponsor can show that
they reduce congestion, increase mobility and provide
alternatives to single occupant vehicle travel. Selection of
w>«ÀiVÌÃÃ >LiL>Ãi`>«iÀvÀ>Vi>>ÞÃÃv
project alternatives consistent with Authority requirements.
Projects funded from this category must be on or near
the I-680 or the SR 24 corridors. Of the funds assigned
to this category in Southwest County, $20 million will be
eligible for interchange improvements on the SR 24. To
the greatest degree possible, local funds generated by
this measure shall be used to leverage additional regional,
state and/or federal funds for this project.
i
06-10-19 TWIC Meeting Agenda
Packet Pg.86 of 192
17ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
East County Corridor OKNNKQP
(Vasco Road and/or Byron Highway Corridors) Improvements
The Authority shall provide funding to construct a new
2-lane “limited access” connector between Byron Highway
and Vasco Road south of Camino Diablo Road as well as
shoulder and other improvements to the Byron Highway
(including a railroad grade separation) to improve safety
and access to the Byron Airport and to facilitate economic
development and access for goods movement in East
Contra Costa County. For the Vasco Road corridor, the
Authority shall provide funding for safety and other
improvements oriented at facilitating the use of high-
capacity transit and/or high occupancy carpools. To the
greatest degree possible, local funds generated by this
measure shall be used to leverage additional regional,
state and/or federal funds for these projects.
Prior to the use of any local sales tax funds to implement
capacity improvements to either or both of these corridors,
Ì iƂÕÌ ÀÌÞ >À`ÕÃÌ>i>w`}Ì >ÌÌ i«ÀiVÌî
include measures to prevent growth outside of the Urban
Limit Lines (ULL). Such measures might include, but are not
necessarily limited to, limits on roadway access in areas
outside the ULL, purchase of abutters’ rights of access,
preservation of critical habitat and/or the permanent
protection/acquisition of agricultural and open space
or performing conservation measures required to cover
this project under the East Contra Costa County Habitat
Conservation Plan/Natural Community Conservation Plan
(HCP/NCP). With the exception of the new connection
between Vasco Road and the Byron Highway, funding from
this category shall not be used to construct new roadways
on new alignments. The Authority will work with Alameda
and/or San Joaquin Counties to address project impacts in
those jurisdictions.
,i`ÕV}
}iÃÌ>`-Ì }/À>vwV
06-10-19 TWIC Meeting Agenda
Packet Pg.87 of 192
18 ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
/À>vwVÜ«ÀÛiiÌÃč}Ì i-,Ó{Ó>`-,{$108 million
This category is intended to provide funding to improve
ÌÀ>vwV yÜ >` Ài`ÕVi V}iÃÌ LiÌÜii
VÀ`
and Brentwood along State Route 242 and State Route
4 to reduce congestion, increase mobility and provide
alternatives to single occupant vehicle travel. To the
greatest degree possible, local funds generated by this
measure shall be used to leverage additional regional,
ÃÌ>Ìi>`ÉÀvi`iÀ>vÕ`ÃvÀÌ Ã«ÀiVÌ°Ƃ`Û>Vi`ÌÀ>vwV
management programs and/or other projects or programs
that encourage the use of connected vehicle and/or
autonomous vehicles in the corridor are eligible for funding
from this category provided that the project sponsor can
demonstrate that they reduce congestion, increase mobility
and provide alternatives to single occupant vehicle travel.
Projects funded from this category must be on or near the
-,Ó{ÓÀ-,{VÀÀ`Àð-iiVÌvw>«ÀiVÌîà >
be based on a performance analysis of project alternatives
consistent with Authority requirements.
,i`ÕV}
}iÃÌ>`-Ì }/À>vwV
06-10-19 TWIC Meeting Agenda
Packet Pg.88 of 192
19ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
This category is intended to fund improvements of the I-80
interchanges at San Pablo Dam Road, Central Avenue,
and other locations along I-80 in consultation with the
subregion. The improvements of the interchanges are a
«ÀÀÌÞÌ}>VÀÀ`ÀÌÀ>vwVyÜ«ÀÛiiÌð
I-80 Interchange Improvements at $60 million
San Pablo Dam Road and Central Avenue
Interstate 680/State Route 4 Interchange OKNNKQP
This category is intended to fund an Interstate 680/State
Route 4 interchange improvement project as necessary
Ì«ÀÛiÌÀ>vwVyÜ>`i >ViÌÀ>vwVÃ>viÌÞ>}
both the I-680 and SR 4 corridors. To the greatest degree
possible, local funds generated by this measure shall be
used to leverage additional regional, state and/or federal
funds for this project. Authority shall prioritize local funding
commitments to this project in such a way as to encourage
carpools and vanpools, public transit usage and other
alternatives to the single occupant vehicle.
,i`ÕV}
}iÃÌ>`-Ì }/À>vwV
06-10-19 TWIC Meeting Agenda
Packet Pg.89 of 192
20
,i`ÕV}
}iÃÌ>`-Ì }/À>vwV
Fixing Local Streets
and Roads
23.8%
06-10-19 TWIC Meeting Agenda
Packet Pg.90 of 192
21
Reduces Congestion
Reduces Greenhouse Gas Emissions
Improves BART Service
Improves Bus Service
Expands Bicycle Access/Improves Bicycle Safety
Improves Pedestrian Safety
Improves Transportation Connectivity
Provides Alternatives to Single-Occupant Vehicle Use
Integrates New Technology
Creates Good Local Jobs
i
$GPGƂVU-G[
>V VÀi«ÀiÃiÌÃ>LiiwÌÌ
ÌÀ>
ÃÌ>
ÕÌÞ>Ã>ÀiÃÕÌvÌ i«ÀÌvÌ i
plan being described.
06-10-19 TWIC Meeting Agenda
Packet Pg.91 of 192
22 ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
Local Street Maintenance & Improvements OKNNKQP
This category is intended to fund maintenance and
improvement projects on local streets and roads and may
LiÕÃi`vÀ>Þi}LiÌÀ>ëÀÌ>Ì«ÕÀ«ÃiÃ>Ã`iwi`
under the Act. The Authority will distribute 23.1 percent
of the annual sales tax revenues to all local jurisdictions
with a base allocation of $100,000 for each jurisdiction,
the balance will be distributed based 50 percent on
relative population and 50 percent on road miles for each
jurisdiction, subject to compliance with the Authority’s
reporting, audit and GMP requirements. Population
w}ÕÀiÃÕÃi`Ã >LiÌ iÃÌVÕÀÀiÌ>Û>>LivÀÌ i
State Department of Finance. Road mileage shall be from
the most current information included in the Highway
Performance Monitoring System (HPMS)
Funds shall be used by each jurisdiction to maintain and
enhance existing roadway and other transportation facilities.
Jurisdictions shall comply with the Authority’s Maintenance
of Effort (MOE) policy as well as Implementation Guidelines
of this TEP. Local agencies will report on the use of these
funds, such as the amount spent on roadway maintenance,
bicycle and pedestrian facilities, transit facilities, and other
roadway improvements.
This subcategory is intended to fund additional maintenance
and improvement projects on local streets and roads. These
additional funds will be allocated to Central Contra Costa
County jurisdictions based on the formula of 50 percent on
relative population and 50 percent on road miles for each
jurisdiction and subject to program requirements detailed
above.
Additional Local Street Maintenance & Improvements OKNNKQP
Fixing Local Streets and RoadsLocal Streets and Roads
06-10-19 TWIC Meeting Agenda
Packet Pg.92 of 192
Providing Affordable and
Safe Transportation for
Children, Seniors and
People with Disabilities
6.2%
06-10-19 TWIC Meeting Agenda
Packet Pg.93 of 192
Reduces Congestion
Reduces Greenhouse Gas Emissions
Improves BART Service
Improves Bus Service
Expands Bicycle Access/Improves Bicycle Safety
Improves Pedestrian Safety
Improves Transportation Connectivity
Provides Alternatives to Single-Occupant Vehicle Use
Integrates New Technology
Creates Good Local Jobs
i
$GPGƂVU-G[
>V VÀi«ÀiÃiÌÃ>LiiwÌÌ
ÌÀ>
ÃÌ>
ÕÌÞ>Ã>ÀiÃÕÌvÌ i«ÀÌvÌ i
plan being described.
25
06-10-19 TWIC Meeting Agenda
Packet Pg.94 of 192
26 ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
Safe Transportation for Children OKNNKQP
This category is to provide funds to programs and projects
that promote safe transportation options for children to
access schools or after school programs. Eligible projects
include but are not limited to reduced fare transit passes
and transit incentive programs, school bus programs, and
projects for pedestrian and bicycle safety that provide
school-related access.
The Authority will allocate funds and will establish
}Õ`iiÃV«iÀ>ÌÜÌ «ÀiVÌëÃÀîÌ`iwi
priorities and maximize effectiveness. The guidelines
may require provisions such as parent contributions;
«iÀ>Ì>ivwViViÃÆëiVwV«iÀvÀ>ViVÀÌiÀ>>`
reporting requirements.
i
Providing Affordable and Safe Transportation for Children, Seniors and People with Disabilities
06-10-19 TWIC Meeting Agenda
Packet Pg.95 of 192
ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube 27
Providing Affordable and Safe Transportation for Children, Seniors and People with Disabilities
Transportation for Seniors & People With Disabilities OKNNKQP
Funding in this category is to support mobility opportunities
for seniors and people with disabilities who, due to age or
disability, cannot drive or take other transit options.
To ensure services are delivered in a coordinated system
Ì >Ì >Ýâià LÌ ÃiÀÛVi `iÛiÀÞ >` ivwViVÞ] >
Accessible Transportation Service (ATS) Strategic Plan
will be developed and periodically updated during the
term of the measure. No funding under this category
will be allocated until the ATS Strategic Plan has been
developed and adopted. An overarching component in
the development and delivery of the ATS Strategic Plan
is using mobility management to ensure coordination
>` ivwViVià >VViÃÃLi ÃiÀÛVi `iÛiÀÞ° / i
plan will address both Americans with Disabilities Act
(ADA) and non-ADA services. The plan will evaluate the
appropriate model for our local structure including how
accessible services are delivered by all agencies and where
appropriate coordination can improve transportation
ÃiÀÛViÃ]i>Ìi}>«ÃÃiÀÛVi>`w`ivwViViÃ
the service delivered. The ATS Strategic Plan would also
determine the investments and oversight of the program
funding and identify timing, projects, service delivery
options, administrative structure, and fund leverage
opportunities.
The ATS Strategic Plan will be developed by the Authority,
in consultation with direct users of service, stakeholders
representing seniors and people with disabilities who face
LÌÞ L>ÀÀiÀÃ] >` «ÀwÌ >` «ÕLVÞ «iÀ>Ìi`
paratransit service providers. Public operators in Contra
Costa must participate in the ATS planning process to
be eligible to receive funding in this category. The ATS
Strategic Plan must be adopted no later than April 1, 2018.
The development of the ATS Strategic Plan will not affect
the allocation of funds to current operators as prescribed
in the existing Measure J Expenditure Plan.
Accessible Transportation Service (ATS) Strategic Plan
06-10-19 TWIC Meeting Agenda
Packet Pg.96 of 192
Building Sustainable
Communities and
Protecting the Environment
22.0%
06-10-19 TWIC Meeting Agenda
Packet Pg.97 of 192
Reduces Congestion
Reduces Greenhouse Gas Emissions
Improves BART Service
Improves Bus Service
Expands Bicycle Access/Improves Bicycle Safety
Improves Pedestrian Safety
Improves Transportation Connectivity
Provides Alternatives to Single-Occupant Vehicle Use
Integrates New Technology
Creates Good Local Jobs
i
$GPGƂVU-G[
>V VÀi«ÀiÃiÌÃ>LiiwÌÌ
ÌÀ>
ÃÌ>
ÕÌÞ>Ã>ÀiÃÕÌvÌ i«ÀÌvÌ i
plan being described.
29
06-10-19 TWIC Meeting Agenda
Packet Pg.98 of 192
30 ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
Building Sustainable Communities and Protecting the Environment
>À-ÌÀiiÌÃ]
«iÌi-ÌÀiiÌÃ]>`/À>vwV-ÞV Àâ>Ì*ÀiVÌÀ>ÌÃOKNNKQP
This category is intended to fund improvements to major
thoroughfares throughout Contra Costa to improve the
Ã>vi]ivwViÌ>`Ài>LiÛiiÌvLÕÃiÃ]Ûi ViÃ]
LVÞVÃÌÃ>`«i`iÃÌÀ>Ã>}Ã>`VÀÀ`Àði°ÌÀ>vwV
smoothing). Eligible projects shall include a variety of
components that meet the needs of all users and respond
to the context of the facility. Projects may include but are
not limited to installation of bike and pedestrian facilities,
installation of “smart” parking management programs,
Ãi«>À>Ìi` Li >iÃ] ÃÞV Àâ>Ì v ÌÀ>vwV Ã}>Ã
>`Ì iÀÌiV }ÞÃÕÌÃÌ>>}iÌÀ>vwV]ÌÀ>vwV
calming and pedestrian safety improvements, shoulders,
sidewalks, curbs and gutters, streetscapes and bus transit
facility enhancements such as bus turnouts and passenger
amenities. As an element of this program, the Authority
Ü>`«Ì>¼ÌÀ>vwVÃ}>ÃÞV Àâ>̽«À}À>>`
award grants for installation of ‘state of the art’ technology
`iÃ}i`ÌÃÌ Ì iyÜvÌÀ>vwV>}>À>ÀÌiÀ>
roadways throughout the county. Funding from this
program will be prioritized to projects that improve access
for all modes to jobs, commercial areas and transit, and
the design process which includes opportunity for public
input from existing and potential users of the facility.
Priority will be given to projects that can show a high
percentage of “other funding” allocated to the project (i.e.
– leverage). The Authority will adopt program guidelines
that will include information regarding how to evaluate the
range of possible project components. All projects will be
selected through a competitive project selection process
within each subregion with the Authority approving the
w>«À}À>v«ÀiVÌÃ]>Ü}vÀ>V«Ài iÃÛi
countywide approach while recognizing subregional
needs to achieve the overall program goal. All projects
funded through this program must comply with the
Authority’s Complete Streets Policy and include complete
street elements whenever possible. Twenty percent of
the program funding will be allocated to four Complete
Streets demonstration projects, one in each subregion,
recommended by the relevant RTPC and approved by
Authority, to demonstrate the successful implementation
of Complete Streets projects no later than April 1, 2022..
Projects will be required to strongly pursue the use of
separated bike lane facilities in the demonstration project
program. The purpose of these demonstration projects is
to create examples of successful complete street projects
in multiple situations throughout the county.
i
06-10-19 TWIC Meeting Agenda
Packet Pg.99 of 192
31ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
Building Sustainable Communities and Protecting the Environment
Pedestrian, Bicycle and Trail Facilities OKNNKQP
Two-thirds of the funds from this program shall be used
to implement projects in the Countywide Bicycle and
Pedestrian Plan, consistent with the current Measure J
program. These funds shall be allocated to projects that
improve safety for pedestrians and bicyclists, serve the
}Ài>ÌiÃÌ ÕLiÀ v ÕÃiÀÃ >` Ã}wV>Ì `iÃÌ>ÌÃ]
and remove missing segments and existing barriers
to walking and bicycling. All projects will be selected
through a competitive project selection process within
i>V ÃÕLÀi} ÜÌ Ì i ƂÕÌ ÀÌÞ >««ÀÛ} Ì i w>
program of projects, allowing for a comprehensive
countywide approach while recognizing subregional
needs to achieve the overall program goal. The review
process shall consider project feasibility and readiness and
the differing needs of the sub-regions when identifying
projects for funding. Funding available through this
program is to be primarily used to construct and maintain
bicycle, pedestrian and trail facilities, as well as to make
safety or other improvements to bicycle, pedestrian and
trail facilities. Planning to identify a preferred alignment
for major new bicycle, pedestrian or trail connections may
also be funded through this program.
One-third of the funds are to be allocated to the East Bay
Regional Park District (EBRPD) for the development and
rehabilitation of paved regional trails. EBRPD is to spend
its allocation proportionally in each sub-region, subject
to the review and approval of the conceptual planning/
design phase by the applicable sub-regional committee,
prior to funding allocation by the Authority. The Authority
in conjunction with EBRPD will develop a maintenance-of-
effort requirement for funds under this component of the
funding category.
Consistent with the Countywide Bicycle and Pedestrian
Plan and the complete streets policy established in this
expenditure plan, project sponsors receiving funding
through other funding categories in this Plan shall
incorporate, whenever possible, pedestrian, bicycle, and
trail facilities into their projects.
i
06-10-19 TWIC Meeting Agenda
Packet Pg.100 of 192
32 ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
Building Sustainable Communities and Protecting the Environment
Community Development Transportation Program OKNNKQP
This category is intended to provide funding to implement
a new Community Development Transportation Program
(CDTP) to be administered by the Authority in conjunction
with the Authority’s existing Transportation for Livable
ÕÌiÃ*À}À>/
®ÜÌ «ÀiVÌÃ`iÌwi`LÞÌ i
Authority’s Regional Transportation Planning Committees
(RTPCs). Funds will be allocated by the Authority on a
competitive basis to transportation projects or programs
that promote housing within planned or established
centers that are supported by transit, or that support
economic development and job creation in Contra Costa
County. All projects will be selected through a competitive
project selection process within each subregion with
Ì i ƂÕÌ ÀÌÞ >««ÀÛ} Ì i w> «À}À> v «ÀiVÌÃ]
allowing for a comprehensive countywide approach while
recognizing subregional needs to achieve the overall
program goal. Project sponsors must demonstrate that
at least 20 percent of the project is funded from other
than local transportation sales tax revenue. Additional
priority will be given to projects where the sponsor can
demonstrate that the project supports and facilitates
development of jobs or housing for all income levels and
that have additional matching funds that have already
been committed or secured. Working with the RTPCs,
the Authority will prepare guidelines and establish overall
criteria for the program with the intent of complementing
and administering the program in conjunction with
the Authority’s Measure J TLC program no later than
December 31, 2017.
i
06-10-19 TWIC Meeting Agenda
Packet Pg.101 of 192
33ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
Building Sustainable Communities and Protecting the Environment
Innovative Transportation Technology/Connected Communities Program OKNNKQP
This category is intended to provide funding for the
planning and development of projects and programs that
include innovative solutions intended to (a) develop and
demonstrate transportation innovation through real-world
applications, (b) reduce GHG emissions, and (c) implement
connected transportation solutions. The Authority intends
innovative solutions to include installing new digital and
communications infrastructures, automated processes and
intelligent controls, and integration with other community
services, such as public safety and communications
providers, to support a more integrated transportation
system that promotes economic development, expanded
L ««ÀÌÕÌiÃ] VÀi>Ãi` }ÛiÀiÌ ivwViVÞ]
reductions in consumption of nonrenewable resources,
and increased sustainability, safety and mobility. Examples
of eligible projects include but are not limited to expanding
opportunities for zero emission vehicle charging; smart
rideshare, carshare and bikeshare services; on-demand and
«iÀÃ>ÌÀ>ÃÌÃiÀÛViÃÌ >ÌV«iiÌÌÀ>`Ì>wÝi`
route transit; smart and automated parking; intelligent,
sensor-based infrastructure; smart payment systems; and
data sharing to improve mobility choices for all users.
Projects are intended to promote connectivity between
all users of the transportation network (cars, pedestrians,
bikes, buses, trucks, etc.) and automation technologies that
collectively facilitate the transformation toward connected
communities. Funding is intended to match State, federal,
or regional grants and private-sector investment to achieve
>ÝÕLiiwÌð ÞÛiÃÌ}Ì iÃiÃÕÌÃ]
ÌÀ>
Costa County can become a national model in sustainable,
technology-enabled transportation.
Ƃ Õ v ÌÜiÌÞwÛi «iÀViÌ Ã Ì Li >V>Ìi`
to each sub-program (a, b and c above) over the life of
the measure. The Authority will prepare guidelines and
establish overall criteria for the Innovative Transportation
Technology/Connected Communities Program and
provide technical resources to project sponsors. All
programs/projects will be selected through a competitive
project selection process within each subregion with
Ì i ƂÕÌ ÀÌÞ >««ÀÛ} Ì i w> «À}À>ÃÉ«ÀiVÌÃ vÀ
each of the sub-programs, allowing for a comprehensive
countywide approach while recognizing subregional needs
to achieve the overall program goal.
Project sponsors must demonstrate that the programs
«ÀÛ`i } Þ ivwViÌ ÃiÀÛViÃ Ì >Ì >Ài VÃÌ ivviVÌÛi]
integrated and responsive to the needs of the community.
i
06-10-19 TWIC Meeting Agenda
Packet Pg.102 of 192
34 ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
Building Sustainable Communities and Protecting the Environment
Regional Transportation Priorities OKNNKQP
This category is intended to fund any project or program
`iÌwi`Ì i
Ý«i`ÌÕÀi*>Ài}LiÕ`iÀÌ i
provisions of the Act, including activities that promote
alternatives to travel in single occupant vehicles. Program
and project recommendations shall be made by each
subregion for consideration and funding by the Authority.
Transportation Planning, Facilities and Services OKNNKQP
This category is intended to provide funding to implement
the countywide Growth Management Program, prepare
the countywide transportation plan, and support the
programming and monitoring of federal and state funds,
as well as the Authority’s Congestion Management Agency
functions.
i
i
Building Sustainable Communities and Protecting the Environment
06-10-19 TWIC Meeting Agenda
Packet Pg.103 of 192
Policy Statements
06-10-19 TWIC Meeting Agenda
Packet Pg.104 of 192
37ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
1 The Authority will, to the extent possible, attempt to harmonize the Growth Management and the State-mandated Congestion
>>}iiÌ*À}À>ð/Ì iiÝÌiÌÌ iÞVyVÌ]
}iÃÌ >>}iiÌ*À}À>ƂVÌÛÌiÃÃ >Ì>i«ÀiVi`iViÛiÀÀÜÌ
Management activities.
The Growth Management Program
>Ã>`"LiVÌÛiÃ
The overall goal of the Growth Management Program is to preserve and enhance the quality of life and promote a
i>Ì Þ]ÃÌÀ}iVÞÌLiiwÌÌ i«i«i>`>Ài>Ãv
ÌÀ>
ÃÌ>Ì ÀÕ} >V«iÀ>ÌÛi]ÕÌÕÀÃ`VÌ>
process for managing growth, while maintaining local authority over land use decisions.1
The objectives of the Growth Management Program are to:
• Assure that new residential, business and commercial growth pays for the facilities required to meet the demands
resulting from that growth.
• Require cooperative transportation and land use planning among Contra Costa County, cities, towns, and
transportation agencies.
• -Õ««ÀÌ>`ÕÃi«>ÌÌiÀÃÜÌ
ÌÀ>
ÃÌ>Ì >Ì>iÀiivwViÌÕÃivÌ iÌÀ>ëÀÌ>ÌÃÞÃÌi]
consistent with the General Plans of local jurisdictions.
• -Õ««ÀÌw>`Ài`iÛi«iÌiÝÃÌ}ÕÀL>>`LÀÜwi`>Ài>ð
The Measure J Transportation Expenditure Plan Growth Management Program, which includes Attachment A:
Principles of Agreement for Establishing the Urban Limit Line, is replaced in its entirety by this Growth Management
*À}À>>`ƂÌÌ>V iÌƂ\1ÀL> Ì i1 ® iwÌÃ>`
«>Vi,iµÕÀiiÌð
Components
To receive its share of the 2016 Transforming Contra Costa County Expenditure Plan funding from Local Streets
Maintenance and Improvements funds and its share of Contra Costa’s Measure J Transportation Sales Tax
Expenditure Plan Local Streets Maintenance & Improvements funding and to be eligible for Contra Costa’s Measure
J Transportation Sales Tax Expenditure Transportation for Livable Communities funds and the 2016 Transforming
Contra Costa County Expenditure Plan funding from Community Development Transportation Program funds each
jurisdiction must:
1. Adopt a Growth Management Element
Each jurisdiction must adopt, or maintain in place, a Growth Management Element as part of its General Plan that
outlines the jurisdiction’s goals and policies for managing growth and requirements for achieving those goals. The
Growth Management Element must show how the jurisdiction will comply with sections 2–8 below. The Authority
ÜÀiwiÌÃ`iÀÜÌ >>}iiÌ
iiÌ>`>`ÃÌÀ>ÌÛi«ÀVi`ÕÀiÃVÃÕÌ>ÌÜÌ Ì i,i}>
/À>ëÀÌ>Ì*>}
ÌÌiiÃÌÀiyiVÌÌ iÀiÛÃi`ÀÜÌ >>}iiÌ*À}À>°
Each jurisdiction is encouraged to incorporate other standards and procedures into its Growth Management Element
to support the objectives and required components of this Growth Management Program.
2. Adopt a Development Mitigation Program
Each jurisdiction must adopt, or maintain in place, a development mitigation program to ensure that new growth is
paying its share of the costs associated with that growth. This program shall consist of both a local program to mitigate
impacts on local streets and other facilities and a regional program to fund regional and subregional transportation
projects, consistent with the Countywide Comprehensive Transportation Plan.
06-10-19 TWIC Meeting Agenda
Packet Pg.105 of 192
38 ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
The jurisdiction’s local development mitigation program shall ensure that revenue provided from this measure shall not
be used to replace private developer funding that has or would have been committed to any project.
The regional development mitigation program shall establish fees, exactions, assessments or other mitigation measures to fund
regional or subregional transportation improvements needed to mitigate the impacts of planned or forecast development.
Regional mitigation programs may adjust such fees, exactions, assessments or other mitigation measures when developments
>ÀiÜÌ Ü>}`ÃÌ>VivvÀiµÕiÌÌÀ>ÃÌÃiÀÛViÀ>Ài«>ÀÌv>Ýi`ÕÃi`iÛi«iÌvÃÕvwViÌ`iÃÌÞ>`ÜÌ
necessary facilities to support greater levels of walking and bicycling. Each Regional Transportation Planning Committee shall
develop the regional development mitigation program for its region, taking account of planned and forecast growth and
the Multimodal Transportation Service Objectives and actions to achieve them established in the Action Plans for Routes
v,i}>-}wV>Vi°,i}>/À>ëÀÌ>Ì*>}
ÌÌiiÃ>ÞÕÃiiÝÃÌ}Ài}>Ì}>Ì«À}À>Ã]v
consistent with this section, to comply with the Growth Management Program.
3. Address Housing Options
Each jurisdiction shall demonstrate reasonable progress in providing housing opportunities for all income levels as part of a
report on the implementation of the actions outlined in its adopted Housing Element. The report will demonstrate progress by:
a. Comparing the number of housing units approved, constructed or occupied within the jurisdiction over the
«ÀiVi`}wÛiÞi>ÀÃÜÌ Ì iÕLiÀvÕÌÃii`i`>ÛiÀ>}ii>V Þi>ÀÌiiÌÌ i ÕÃ}LiVÌÛiÃ
established in the jurisdiction’s Housing Element; or
b. Illustrating how the jurisdiction has adequately planned to meet the existing and projected housing
needs through the adoption of land use plans and regulatory systems which provide opportunities for, and
do not unduly constrain, housing development; or
c. Illustrating how a jurisdiction’s General Plan and zoning regulations facilitate the improvement and development
vÃÕvwViÌ ÕÃ}ÌiiÌÌ ÃiLiVÌÛið
In addition, each jurisdiction shall consider the impacts that its land use and development policies have on the local,
regional and countywide transportation system, including the level of transportation capacity that can reasonably be
provided, and shall incorporate policies and standards into its development approval process that support transit,
bicycle and pedestrian access in new developments.
4. Participate in an Ongoing Cooperative, Multi-Jurisdictional Planning Process.
Each jurisdiction shall participate in an ongoing process with other jurisdictions and agencies, the Regional Transportation
*>}
ÌÌiiÃ>`Ì iƂÕÌ ÀÌÞÌVÀi>Ìi>L>>Vi`]Ã>vi>`ivwViÌÌÀ>ëÀÌ>ÌÃÞÃÌi>`Ì>>}iÌ i
impacts of growth. Jurisdictions shall work with the Regional Transportation Planning Committees to:
>°`iÌvÞ,ÕÌiÃv,i}>-}wV>Vi]>`iÃÌ>Là ÕÌ`>/À>ëÀÌ>Ì-iÀÛVi"LiVÌÛiÃÀÌ iÀ
ÌÃ>`«Ìi`LÞÌ iƂÕÌ ÀÌÞvÀi>ÃÕÀ}«iÀvÀ>Vi>`µÕ>ÌÞvÃiÀÛVi>}ÀÕÌiÃvÃ}wV>Vi]
collectively referred to as Multimodal Transportation Service Objectives for those routes and actions for
achieving those objectives.
b. Apply the Authority’s travel demand model and technical procedures to the analysis of General Plan
Ƃi`iÌÃ*Ƃî>``iÛi«iÌÃiÝVii`}ëiVwi`Ì Àià `ÃvÀÌ iÀivviVÌÌ iÀi}>
transportation system, including on Action Plan objectives.
c. Create the development mitigation programs outlined in section 2 above.
d. Help develop other plans, programs and studies to address other transportation and growth management issues.
In consultation with the Regional Transportation Planning Committees, each jurisdiction will use the travel demand model
06-10-19 TWIC Meeting Agenda
Packet Pg.106 of 192
39ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
to evaluate changes to local General Plans and the impacts of major development projects for their effects on the local and
regional transportation system and the ability to achieve the Multimodal Transportation Service Objectives established in
the Action Plans.
Jurisdictions shall also participate in the Authority’s ongoing countywide comprehensive transportation planning process.
As part of this process, the Authority shall support countywide and subregional planning efforts, including the Action
*>ÃvÀ,ÕÌiÃv,i}>-}wV>Vi]>`Ã >>Ì>>ÌÀ>Ûi`i>``i°ÕÀÃ`VÌÃÃ > i«>Ì>Ì i
Authority’s travel demand modeling system by providing information on proposed improvements to the transportation
system and planned and approved development within the jurisdiction.
5. Continuously Comply with an Urban Limit Line (ULL)
In order to be found in compliance with this element of the Authority’s Growth Management Program, all jurisdictions
must continually comply with an applicable voter approved Urban Limit Line (ULL). Said ULL may either be the Contra
Costa County voter approved ULL (County ULL) or a locally initiated, voter approved ULL (LV- ULL).
Ƃ``Ì>vÀ>Ì>``iÌ>i`V«>ViÀiµÕÀiiÌÃvÀÌ i1 >ÀivÕÞ`iwi`Ì i1
«>Vi
Requirements, which are incorporated herein as Attachment A.
Any of the following actions by a local jurisdiction will constitute non-compliance with the Growth Management Program:
1. The submittal of an annexation request to Local Agency Formation Commission ( LAFCO) for lands outside of a
jurisdiction’s applicable ULL.
2. Failure to conform to the Authority’s ULL Compliance Requirements (Attachment A).
6. Develop a Five-Year Capital Improvement Program
Each jurisdiction shall prepare and maintain a capital improvement program that outlines the capital projects needed to
«iiÌÌ i}>Ã>`«ViÃvÌ iÕÀÃ`V̽ÃiiÀ>*>vÀ>Ìi>ÃÌÌ ivÜ}wÛiÞi>À«iÀ`°/ i
>«Ì>
Improvement Program shall include approved projects and an analysis of the costs of the proposed projects as well as a
w>V>«>vÀ«ÀÛ`}Ì i«ÀÛiiÌð/ iÕÀÃ`VÌà >vÀÜ>À`Ì iÌÀ>ëÀÌ>ÌV«iÌvÌÃV>«Ì>
improvement program to the Authority for incorporation into the Authority’s database of transportation projects.
7. Adopt a Transportation Systems Management (TSM) Ordinance or Resolution
To promote carpools, vanpools and park and ride lots, each jurisdiction shall adopt a local ordinance or resolution that
conforms to the model Transportation Systems Management Ordinance that the Transportation Authority has drafted
and adopted. Upon approval of the Authority, cities with a small employment base may adopt alternative mitigation
measures in lieu of a TSM ordinance or resolution.
8. Adopt Additional Growth Management Policies, as applicable
Each jurisdiction shall adopt and thereafter continuously maintain the following policies (where applicable): a hillside
development policy, a ridgeline protection policy, a wildlife corridor policy and a creek development policy. Where a
jurisdiction does not have a developable hillside, ridgeline, wildlife corridor or creek, in need to adopt a corresponding
policy. An ordinance that implements the East Contra Costa HCP/NCCP shall satisfy the requirement to have an adopted
wildlife corridor policy and creek development policy. In addition to the above, jurisdictions with Prime Farmland and
>À>`v-Ì>ÌiÜ`i«ÀÌ>Vi>Ã`iwi`LÞÌ i
>vÀ> i«Ì°v
ÃiÀÛ>Ì>`>««i`LÞ *®ÜÌ Ì iÀ
planning areas but outside of their city shall adopt and thereafter continuously maintain an Agricultural Protection Policy.
The policy must ensure that potential impacts of converting Prime Farmland and Farmland of Statewide Importance
ÕÌÃ`iÌ i1 ÌÌ iÀÕÃiÃ>Ài`iÌwi`>``ÃVÃi`Ü iVÃ`iÀ}ÃÕV >VÛiÀð/ i>««V>Li«ViÃ
are required to be in place by no later than April 1, 2019.
06-10-19 TWIC Meeting Agenda
Packet Pg.107 of 192
40 ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
Allocation of Funds
Portions of the monies received from the retail transaction and use tax will be returned to the local jurisdictions (the cities
and the county) for use on local, subregional and/or regional transportation improvements and maintenance projects.
Receipt of all such funds requires compliance with the Growth Management Program and the allocation procedures
described below. The funds are to be distributed on a formula based on population and road miles.
Each jurisdiction shall demonstrate its compliance with all of the components of the Growth Management Program
>V«iÌi`V«>ViV iVÃÌ°/ iÕÀÃ`VÌÃ >ÃÕLÌ]>`Ì iƂÕÌ ÀÌÞÃ >ÀiÛiÜ>`>iw`}Ã
regarding the jurisdiction’s compliance with the requirements of the Growth Management Program, consistent with the
Authority’s adopted policies and procedures.
If the Authority determines that the jurisdiction complies with the requirements of the Growth Management Program,
it shall allocate to the jurisdiction its share of 2016 Transforming Contra Costa County Expenditure Plan funding from
Local Streets Maintenance and Improvements funding and its share of Contra Costa’s Measure J Transportation Sales Tax
Expenditure Plan Local Streets Maintenance & Improvements funding. Jurisdictions may use funds allocated under this
provision to comply with these administrative requirements.
If the Authority determines that the jurisdiction does not comply with the requirements of the Growth Management Program,
Ì iƂÕÌ ÀÌÞà >ÜÌ `Ì ÃivÕ`Ã>`>Ã>i>w`}Ì >ÌÌ iÕÀÃ`VÌà >ÌLii}LiÌÀiViÛiÓä£È
Transforming Contra Costa County Expenditure Plan funding from Community Development Transportation Program funds
or Contra Costa’s Measure J Transportation Sales Tax Expenditure Plan Transportation for Livable Communities funds until the
ƂÕÌ ÀÌÞ`iÌiÀiÃÌ iÕÀÃ`VÌ >Ã>V iÛi`V«>Vi°/ iƂÕÌ ÀÌÞ½Ãw`}ÃvV«>Vi>ÞÃiÌ`i>`iÃ
and conditions for achieving compliance.
Withholding of funds, reinstatement of compliance, reallocation of funds and treatment of unallocated funds shall be as
established in adopted Authority’s policies and procedures.
Attachment A
1ÀL> Ì i1 ® iwÌÃ>`
«>Vi,iµÕÀiiÌÃ
iwÌÃÌ ivÜ}`iwÌÃ>««ÞÌÌ i *1 ÀiµÕÀiiÌ\
1. Urban Limit Line (ULL): An urban limit line, urban growth boundary, or other equivalent physical boundary
judged by the Authority to clearly identify the physical limits of the local jurisdiction’s future urban development
2. Local Jurisdictions: Includes Contra Costa County, the 19 cities and towns within Contra Costa, plus any newly
incorporated cities or towns established after April 1, 2017.
3. County ULL: A ULL placed on the ballot by the Contra Costa County Board of Supervisors, approved by voters
at a countywide election, and in effect through the applicable GMP compliance period. The current County ULL
was established by Measure L approved by voters in 2006.
The following local jurisdictions have adopted the County ULL as their applicable ULL:
City of Brentwood Town of Moraga
City of Clayton City of Oakley
City of Concord City of Orinda
Attachment A
1ÀL> Ì i1 ® iwÌÃ>`
«>Vi,iµÕÀiiÌÃ
iwÌÃÌ ivÜ}`iwÌÃ>««ÞÌÌ i *1 ÀiµÕÀiiÌ\
06-10-19 TWIC Meeting Agenda
Packet Pg.108 of 192
41ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
Town of Danville City of Pinole
City of El Cerrito City of Pleasant Hill
City of Hercules City of Richmond
City of Lafayette City of San Pablo
City of Martinez City of Walnut Creek
4. Local Voter ULL (LV-ULL): A ULL or equivalent measure placed on the local jurisdiction ballot, approved by the
jurisdiction’s voters, and recognized by action of the local jurisdiction’s legislative body as its applicable, voter-
approved ULL. The LV-ULL will be used as of its effective date to meet the Authority’s GMP ULL requirement and
must be in effect through the applicable GMP compliance period.
The following local jurisdictions have adopted a LV-ULL:
City of Antioch
City of San Ramon
City of Pittsburg
5. Minor Adjustment: An adjustment to the ULL of 30 acres or less is intended to address unanticipated
circumstances.
6. Other Adjustments: Other adjustments that address issues of unconstitutional takings, and conformance to state
and federal law.
Revisions to the ULL
1. A local jurisdiction which has adopted the County ULL as its applicable ULL may revise its ULL with local voter
approval at any time during the term of the Authority’s GMP by adopting a LV-ULL in accordance with the
ÀiµÕÀiiÌÃÕÌi`vÀ> 61 VÌ>i`Ì i`iwÌÃÃiVÌ°
2. A local jurisdiction may revise its LV-ULL with local voter approval at any time during the term of the Authority’s
*vÌ iÀiÃÕÌ>Ì1 iiÌÃÌ iÀiµÕÀiiÌÃÕÌi`vÀ> 61 VÌ>i`Ì i`iwÌÃÃiVÌ°
3. If voters, through a countywide ballot measure, approve a revision to the County ULL, the legislative body of
each local jurisdiction relying on the County ULL shall:
a. Accept and approve its existing ULL to continue as its applicable ULL, or
b. Accept and approve the revised County ULL as its applicable ULL, or
V°Ƃ`«Ì> 61 >VVÀ`>ViÜÌ Ì iÀiµÕÀiiÌÃÕÌi`vÀ> 61 VÌ>i`Ì i`iwÌÃÃiVÌ°
4. Local jurisdictions may, without voter approval, enact Minor Adjustments to their applicable ULL subject to a
vote of at least 4/5 of the jurisdiction’s legislative body and meeting the following requirements:
a. Minor adjustment shall not exceed 30 acres.
L°Ƃ`«Ìv>Ìi>ÃÌivÌ iw`}ÃÃÌi`Ì i
ÕÌ޽à i>ÃÕÀi ÅnÓ£°ä£nv
ÕÌÞ"À`>ViÃ
ÓääÈäÈÅÎ]££ÅÓ]äÈÈÅ{®Ü V VÕ`i\
• A natural or man-made disaster or public emergency has occurred which warrants the provision of
housing and/or other community needs within land located outside the urban limit line.
• An objective study has determined that the urban limit line is preventing the jurisdiction from providing
its fair share of affordable housing, or regional housing, as required by state law, and the governing
06-10-19 TWIC Meeting Agenda
Packet Pg.109 of 192
42 ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
iiVÌi`i}Ã>ÌÛiL`Þw`ÃÌ >Ì>V >}iÌÌ iÕÀL>ÌiÃiViÃÃ>ÀÞ>`Ì iÞvi>ÃLi
means to enable the county jurisdiction to meet these requirements of state law.
• A majority of the cities that are party to a preservation agreement and the county have approved
a change to the urban limit line affecting all or any portion of the land covered by the preservation
agreement.
• ƂÀV >}iÌÌ iÕÀL>ÌiÜÀi>VVÕÀ>ÌiÞÀiyiVÌÌ«}À>« V>V >À>VÌiÀÃÌVÃÀi}>
boundaries.
• ƂwÛiÞi>ÀVÞVV>ÀiÛiÜvÌ iÕÀL>Ìi >Ã`iÌiÀi`]L>Ãi`Ì iVÀÌiÀ>>`v>VÌÀÃ
for establishing the urban limit line set forth in Contra Costa County Code (Section 82-1.010), that
new information is available (from city, town, or county growth management studies or otherwise) or
circumstances have changed, warranting a change to the urban limit line.
• An objective study has determined that a change to the urban limit line is necessary or desirable to
further the economic viability of the East Contra Costa County Airport, and either (i) mitigate adverse
aviation-related environmental or community impacts attributable to Buchanan Field, or (ii) further the
county’s aviation related needs; or
• A change is required to conform to applicable California or federal law.
V°Ƃ`«Ìv>w`}Ì >ÌÌ i«À«Ãi` ÀƂ`ÕÃÌiÌÜ >Ûi>«ÕLVLiiwÌ°->`«ÕLVLiiwÌVÕ`
include, but is not necessarily limited to, enhanced mobility of people or goods, environmental protections
or enhancements, improved air quality or land use, enhanced public safety or security, housing or jobs,
vÀ>ÃÌÀÕVÌÕÀi«ÀiÃiÀÛ>ÌÀÌ iÀÃ}wV>Ì«ÃÌÛiVÕÌÞivviVÌÃ>Ã`iwi`LÞÌ iV>>`ÕÃi
authority. If the proposed Minor Adjustment to the ULL is proposed to accommodate housing or commercial
development, said proposal must include permanent environmental protections or enhancements such as the
permanent protection of agricultural lands, the dedication of open space or the establishment of permanent
conservation easements.
d. The Minor Adjustment is not contiguous to one or more non-voter approved Minor Adjustments that in total
exceed 30 acres.
i°/ i ÀƂ`ÕÃÌiÌ`iÃÌVÀi>Ìi>«ViÌv>`ÕÌÃ`iÌ iiÝÃÌ}ÕÀL>Ìi]ëiVwV>ÞÌ
>Û`Ì i«ÃÃLÌÞv>ÕÀÃ`VÌÜ>Ì}ÌwÌ ÃiÃÕLÃiµÕiÌÞÌ ÀÕ} Ãi«>À>Ìi>`ÕÃÌiÌð
f. Any jurisdiction proposing to process a minor adjustment to its applicable ULL that impacts Prime Farmland
>`>À>`v-Ì>ÌiÜ`i«ÀÌ>Vi>Ã`iwi`LÞÌ i
>vÀ> i«Ì°v
ÃiÀÛ>Ì>`>««i`LÞ
FMMP) is required to have an adopted Agricultural Protection Ordinance or must demonstrate how the loss of
these agricultural lands will be mitigated by permanently protecting farmland.
5. A local jurisdiction may revise its LV-ULL, and the County may revise the County ULL, to address issues of
unconstitutional takings or conformance to State or federal law.
Conditions of Compliance
1. Submittal of an annexation request of greater than 30 acres by a local jurisdiction to LAFCO outside of a voter-
approved ULL will constitute non-compliance with the GMP.
2. For each jurisdiction, an applicable ULL shall be in place through each GMP compliance reporting period in
order for the local jurisdiction to be found in compliance with the GMP requirements.
«ÕLVLiiwÌ°
f. Any jurisdiction proposing to process a minor adjustment to its applicable ULL that impacts Prime Farmland
>`>À>`v-Ì>ÌiÜ`i«ÀÌ>Vi>Ã`iwi`LÞÌ i
>vÀ> i«Ì°v
ÃiÀÛ>Ì>`>««i`LÞ
FMMP) is required to have an adopted Agricultural Protection Ordinance or must demonstrate how the loss of
these agricultural lands will be mitigated by permanently protecting farmland.
said proposal must include permanent environmental protections or enhancements such as the
permanent protection of agricultural lands, the dedication of open space or the establishment of permanent
conservation easements.
06-10-19 TWIC Meeting Agenda
Packet Pg.110 of 192
43ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
Statement of Policy
Complete Streets Policy
Vision
This Plan envisions a transportation system in which each component provides safe, comfortable and convenient access
for every user allowed to use it. These users include pedestrians, bicyclists, transit riders, automobile drivers and their
passengers, and truckers, and people of varying abilities, including children, seniors, people with disabilities and able-
bodied adults. The goal of every transportation project is to provide safer, more accessible facilities for all users and all
projects shall be planned, designed, constructed and operated to take advantage of that opportunity.
Þ>}ÃÌÀiiÌÃÀiivwViÌ>`Ã>vivÀ>ÕÃiÀÃ]>V«iÌiÃÌÀiiÌÃ>««À>V ÜiÝ«>`V>«>VÌÞ>`«ÀÛi
mobility for all users, giving commuters convenient options for travel and minimizing the need to widen roadways.
Policy
To achieve this vision, all recipients of funding through this Plan shall consider and accommodate, wherever possible and
subject to the Exceptions listed in this Policy, the needs of all users in the planning, design, construction, reconstruction,
rehabilitation and maintenance of the transportation system. This determination shall be consistent with the exceptions
listed below. Achieving this vision will require balancing the needs of different users, and may require reallocating
existing right of way for different uses.
The Authority shall revise its project development guidelines to require the consideration and accommodation of all
users in the design and construction of projects funded with Measure funds and shall adopt peer review and design
ÃÌ>`>À`ÃÌ«iiÌÌ >Ì>««À>V °/ i}Õ`iiÃÜ>ÜyiÝLÌÞÀië`}ÌÌ iVÌiÝÌvi>V «ÀiVÌ
>`Ì iii`ÃvÕÃiÀÃëiVwVÌÌ i«ÀiV̽ÃVÌiÝÌ]>`ÜLÕ`>VVi«Ìi`LiÃÌ«À>VÌViÃvÀV«iÌiÃÌÀiiÌÃ
and context-sensitive design.
To ensure that this policy is carried out, the Authority shall prepare a checklist that sponsors of projects using Measure
funds must submit that documents how the needs of all users were considered and how they were accommodated in the
design and construction of the project. In the checklist, the sponsor will outline how they provided opportunity for public
input, in a public forum, from all users early in the project development and design process. If the proposed project or
program will not provide context appropriate conditions for all users, the sponsor shall document the reasons why in the
checklist, consistent with the following section on “exceptions” below. The completed checklist shall be made part of
the approval of programming of funding for the project or the funding allocation resolution.
Recipients of Local Maintenance and Improvements funds shall adopt procedures that ensure that all agency departments
consider and accommodate the needs of all users for projects or programs affecting public rights of way for which the
agency is responsible. These procedures shall:
1) be consistent with and be designed to implement each agency’s general plan policies once that plan has been
updated to comply with the Complete Streets Act of 2008,
2) involve and coordinate the work of all agency departments and staff whose projects will affect the public right of way,
3) consider the complete street design standards adopted by the Authority, and
4) provide opportunity for public review by all potential users early in the project development and design phase so
that options can be fully considered. This review could be done through an advisory committee such as a Bicycle
and Pedestrian Advisory Committee or as part of the review of the agency’s capital improvement program.
06-10-19 TWIC Meeting Agenda
Packet Pg.111 of 192
44 ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
As part of their biennial Growth Management Program checklist, agencies shall list projects funded by the Measure and
detail how those projects accommodated users of all modes.
As part of the multi-jurisdictional planning required by the Growth Management Program, agencies shall work with the
Authority and the Regional Transportation Planning Committees to harmonize the planning, design and construction
of transportation facilities for all modes within their jurisdiction with the plans of adjoining and connecting jurisdictions.
Exceptions
Project sponsors may provide a lesser accommodation or forgo complete street accommodation components when the
«ÕLVÜÀÃ`ÀiVÌÀÀiµÕÛ>iÌ>}iVÞvwV>w`ÃÌ >Ì\
1. Pedestrians, bicyclists, or other users are prohibited by law from using the transportation facility,
2. The cost of new accommodation would be excessively disproportionate to the need or probable use, or
3. The sponsor demonstrates that, such accommodation is not needed, based on objective factors including:
a. current and projected user demand for all modes based on current and future land use, and
L°>Vv`iÌwi`VyVÌÃ]LÌ iÝÃÌ}>`«ÌiÌ>]LiÌÜii`iÃvÌÀ>Ûi°
*ÀiVÌëÃÀÃà >iÝ«VÌÞ>««ÀÛiiÝVi«ÌÃw`}Ã>ë>ÀÌvÌ i>««ÀÛ>v>Þ«ÀiVÌÕÃ}i>ÃÕÀivÕ`Ã
Ì«ÀÛiÃÌÀiiÌÃV>ÃÃwi`>Ã>>ÀViVÌÀÀ>LÛi°1 Prior to this project sponsors must provide an opportunity
for public input at an approval body (that regularly considers design issues) and/or the governing board of the project
sponsor.
1. >À
iVÌÀÃ>`>LÛi]>Ã`iwi`LÞÌ i
>vÀ> i«>ÀÌiÌv/À>ëÀÌ>Ì
>vÀ>,>`-ÞÃÌi
(CRS maps).
06-10-19 TWIC Meeting Agenda
Packet Pg.112 of 192
45ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
Statement of Policy
Advance Mitigation Program
The Authority is committed to participate in the creation and funding of an Advance Mitigation Program as an innovative
Ü>ÞÌ>`Û>Viii`i`vÀ>ÃÌÀÕVÌÕÀi«ÀiVÌÃÀiivwViÌÞ>`«ÀÛ`iÀiivviVÌÛiVÃiÀÛ>ÌvÕÀ>ÌÕÀ>
resources, watersheds and wetlands, and agricultural lands. As a global biodiversity hot spot, the Bay Area and Contra
Costa County hosts an extraordinarily rich array of valuable natural communities and ecosystems that provide habitat
for rare plants and wildlife, and support residents’ health and quality of life by providing clean drinking water, clean
>À]««ÀÌÕÌiÃvÀÕÌ`ÀÀiVÀi>Ì]«ÀÌiVÌvÀ`Ã>ÃÌiÀÃiy`}]>`Ã`iÃ]>`>`>«Ì>ÌÌV>Ìi
change. The Advance Mitigation Program aims to integrate conservation into infrastructure agencies’ plans and project
development well in advance and on a regional scale to reduce potential impacts of transportation projects, as well
as to drive mitigation dollars to protect regional conservation priorities and protect important ecological functions,
watersheds and wetlands, and agricultural lands that are at threat of loss. The Advance Mitigation Program will provide
iÛÀiÌ>Ì}>Ì>VÌÛÌiÃëiVwV>ÞÀiµÕÀi`Õ`iÀÌ i
>vÀ>
ÛÀiÌ>+Õ>ÌÞƂVÌ
+Ƃ®] >Ì>
Environmental Policy Act (NEPA), Clean Water Act Section 401 and Section 404, and other applicable regulations in the
«iiÌ>ÌvÌ i>À } Ü>Þ]ÌÀ>ÃÌ>`Ài}>>ÀÌiÀ>>`V>ÃÌÀiiÌÃ>`À>`ëÀiVÌÃ`iÌwi`Ì i
Plan.
The Authority’s participation in an Advance Mitigation Program is subject to the following conditions:
£° iÛi«iÌv>,i}>
ÃiÀÛ>ÌƂÃÃiÃÃiÌÉÀ>iÜÀÌ >Ì`iÌwiÃVÃiÀÛ>Ì«ÀÀÌiÃ>`
mitigation opportunities for all of Contra Costa County. The Regional Conservation Assessment/Framework
will include countywide opportunities and strategies that are, among other requirements, consistent with
and support the East Contra Costa County Habitat Conservation Plan/Natural Community Conservation Plan
(East Contra Costa HCP/NCCP) for the areas of the county covered by the East Contra Costa HCP/NCCP. The
Regional Conservation Assessment/Framework will identify mitigation opportunities for all areas of the county to
ensure that mitigation occurs in the vicinity of the project impact to the greatest extent possible. The Authority
will review and approve the Regional Conservation Assessment/Framework, in consultation with the RTPCs,
prior to the allocation of funds for Advance Mitigation Program.
Ó° iÛi«iÌv>*ÀiVÌ«>VÌÃƂÃÃiÃÃiÌÌ >Ì`iÌwiÃÌ i«ÀÌvv«ÀiVÌÃÌLiVÕ`i`Ì i
Advance Mitigation Program and the estimated costs for mitigation of the environmental impacts of the
projects. The Authority will review and approve the Project Impacts Assessment prior to the allocation of funds
for the Advance Mitigation Program. The Assessment and estimated costs do not in any way limit the amount of
mitigation that may be necessary or undertaken for the environmental impacts of the projects.
3. Development of the legislative and regulatory framework necessary to implement an Advance Mitigation
Program in Contra Costa County.
{° / i`iÌwV>ÌvÌ i«iiÌ}Ƃ}iVÞÌ>`ÃÌiÀÌ iƂ`Û>Vi Ì}>Ì*À}À>vÀ
ÌÀ>
ÃÌ>
County or portions of the Bay Area Including Contra Costa County.
The Authority will determine the amount of funds to be dedicated to this Program following the satisfaction of the above
conditions. Funds from the Plan will be allocated consistent with the Regional Conservation Assessment/Framework to
fund environmental mitigation activities required in the implementation of the major highway, transit and regional arterial
>`V>ÃÌÀiiÌÃ>`À>`ëÀiVÌÃ`iÌwi`Ì i*>°vÌ Ã>««À>V V>ÌLivÕÞ«iiÌi`]Ì iÃivÕ`Ãà >
be used for environmental mitigation purposes on a project by project basis. Mitigation required for future transportation
«ÀÛiiÌÃ`iÌwi`Ì i*>>ÀiÌÌi`LÞÌ i>Û>>LÌÞvvÕ`}ÀÌ}>ÌVÀi`ÌÃ>Û>>LiÌ i
Program.
06-10-19 TWIC Meeting Agenda
Packet Pg.113 of 192
46 ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
Projects funded from the following categories of Expenditures are eligible for inclusion in the Advance Mitigation
Program:
• >À-ÌÀiiÌÃ]
«iÌi-ÌÀiiÌÃ>`/À>vwV-ÞV Àâ>Ì*ÀiVÌÀ>ÌÃ
• East Contra Costa Transit Extension
• High Capacity Transit Improvements along the I-80 Corridor in West Contra Costa County
• /À>vwVÜ«ÀÛiiÌÃƂ}Ènä>`-,Ó{
• /À>vwVÜ«ÀÛiiÌÃƂ}-,Ó{Ó>`-,{
• I-80 Interchange Improvements at San Pablo Dam Road and Central Ave
• I-680 and SR 4 Interchange Improvements
• East County Corridor (Vasco Road and/or Byron Highway Corridors)
• Pedestrian, Bicycle and Trail Facilities
• Community Development Transportation Program
06-10-19 TWIC Meeting Agenda
Packet Pg.114 of 192
48 ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
Taxpayer Safeguards
and Accountability
06-10-19 TWIC Meeting Agenda
Packet Pg.115 of 192
49ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
Governing Structure
Governing Body and Administration
/ iƂÕÌ ÀÌÞÃ}ÛiÀi`LÞ> >À`V«Ãi`v££iLiÀÃ]>iiVÌi`vwV>Ã]ÜÌ Ì ivÜ}Ài«ÀiÃiÌ>Ì\
• Two members from the Central County Regional Transportation Planning Commission (RTPC) also referred to as
TRANSPAC
• Two members from the East County RTPC, also referred to as TRANSPLAN
• Two members from the Southwest County RTPC, also referred to as SWAT
• Two members from the West County RTPC, also referred to as WCCTAC
• One member from the Conference of Mayors
• Two members from the Board of Supervisors
/ iƂÕÌ ÀÌÞ >À`>ÃVÕ`iÃÌ ÀiiήiÝvwV]ÛÌ}iLiÀÃ]>««Ìi`LÞÌ i /
] Ƃ,/>`Ì i
Public Transit Operators in Contra Costa County.
The four subregions within Contra Costa: Central, West, Southwest and East County are each represented by a
Regional Transportation Planning Commission (RTPC). Central County (TRANSPAC subregion) includes Clayton,
Concord, Martinez, Pleasant Hill, Walnut Creek and the unincorporated portions of Central County. West County
(WCCTAC subregion) includes El Cerrito, Hercules, Pinole, Richmond, San Pablo and the unincorporated portions of
West County. Southwest County (SWAT subregion) includes Danville, Lafayette, Moraga, Orinda, San Ramon and the
unincorporated portions of Southwest County. East County (TRANSPLAN subregion) includes Antioch, Brentwood,
Oakley, Pittsburg and the unincorporated portions of East County.
Public Oversight Committee
The Public Oversight Committee (Committee) shall provide diligent, independent and public oversight of all expenditures
of Measure funds by Authority or recipient agencies (County, cities and towns, transit operators, etc). The Committee will
report to the public and focus its oversight on the:
• Review of allocation and expenditure of Measure funds to ensure that all funds are used consistent with the
Measure.
• ,iÛiÜvwÃV>>Õ`ÌÃv i>ÃÕÀiiÝ«i`ÌÕÀið
• Review of performance audits of projects and programs relative to performance criteria established by the
Authority, and if performance of any project or program does not meet its established performance criteria,
identify reasons why and make recommendations for corrective actions that can be taken by the Authority Board
for changes to project or program guidelines.
• Review of application of the Performance-based Review policy
• Review of the maintenance of effort compliance requirements of local jurisdictions for local streets, roads and
bridges funding.
• Review of each jurisdiction’s Growth Management Checklist and compliance with the Growth Management Plan
policies.
The Committee shall prepare an annual report including an account of the Committee’s activities during the previous
Þi>À]ÌÃÀiÛiÜ>`ÀiVi`>ÌÃÀi>ÌÛiÌwÃV>À«iÀvÀ>Vi>Õ`ÌÃ]>`>ÞÀiVi`>ÌÃ>`iÌÌ i
06-10-19 TWIC Meeting Agenda
Packet Pg.116 of 192
50 ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
Authority Board for implementing the expenditure plan. The report will be noticed in local media outlets throughout
Contra Costa County, posted to the Authority Website and made continuously available for public inspection at Authority
vwVið/ iÀi«ÀÌà >LiV«Ãi`vi>ÃÞÌÕ`iÀÃÌ>`>}Õ>}iÌ>ÛiÀÞÌiV V>vÀ>Ì°/ i
ÌÌii
shall make an annual presentation to the Authority Board summarizing the annual report subsequent to its release.
ÌÌiiiLiÀÃÃ >LiÃiiVÌi`ÌÀiyiVÌVÕÌÞ]LÕÃiÃÃÀ}>â>ÌÃ>`Ì iÀÌiÀiÃÌÃÜÌ Ì i
County. The goal of the membership makeup of the Public Oversight Committee is to provide a balance of viewpoints
including but not limited to geography, age, gender, ethnicity and income status to represent the different perspectives
of the residents of Contra Costa County. One member will be nominated by each of the four subregions with the RTPC
representing the subregion nominating the member. The Board of Supervisors will nominate four members, with each of
these four members residing in and representing one of the county’s four subregions. Eight members will be nominated
by each respective organization detailed here, with each having one representative: League of Women’s Voters, Contra
Costa Taxpayers Association, East Bay Leadership Council, Building and Construction Trades Council, Central Labor
Council, Paratransit Coordinating Council, Bike East Bay, and environmental and/or open space organizations operating
ÌÀ>
ÃÌ>
ÕÌÞëiVwVÀ}>â>Ì>ÞÛ>ÀÞ`ÕÀ}Ì ivivÌ ii>ÃÕÀi®°ƂLÕÌi >vvÌ iÌ>
member appointments will be for two years and the remaining appointments will be for three year terms. Thereafter,
members will be appointed to two year terms. Any individual member can serve on the Committee for no more than 6
consecutive years.
ÌÌiiiLiÀÃÜLi
ÌÀ>
ÃÌ>
ÕÌÞÀiÃ`iÌÃÜ >ÀiÌiiVÌi`vwV>Ã>Ì>ÞiÛiv}ÛiÀiÌ
À«ÕLVi«ÞiiÃvÀ>}iViÃÌ >ÌiÌ iÀÛiÀÃiiÀLiiwÌvÀÌ i«ÀVii`ÃvÌ i i>ÃÕÀi° iLiÀÃ «
is restricted to individuals with no economic interest in any of Authority’s projects or programs. If a member’s status
changes so that he/she no longer meet these requirements, or if a member resigns his/her position on the Committee,
Ì iƂÕÌ ÀÌÞ >À`ÜÃÃÕi>iÜÃÌ>ÌiiÌvÌiÀiÃÌvÀÌ iÃ>iÃÌ>i `iÀV>Ìi}ÀÞÌwÌ iÛ>V>Ì«ÃÌ°
The Committee shall meet up to once a month to carry out its responsibility, and shall meet at least once every 3 months.
Meetings shall be held at the same location as the Authority Board meetings are usually held, shall be open to the public
and must be held in compliance with California’s open meeting law (Brown Act). Meetings shall be recorded and the
recordings shall be posted for the public.
Members are expected to attend all meetings. If a member, without good reason acceptable to the Chair of the
Committee, fails to attend either (a) two or more consecutive meetings or (b) more than 3 meetings a year, the Authority
Board will request a replacement from the stakeholder categories listed above.
The Authority commits to support the oversight process through cooperation with the Committee by providing access
to project and program information, audits, and other information available to the Authority, and with logistical support
so that the Committee may effectively perform its oversight function. The Committee will have full access to Authority’s
`i«i`iÌ>Õ`ÌÀÃ]>`>ÞÀiµÕiÃÌƂÕÌ ÀÌÞÃÌ>vvLÀiw}ÃvÀ>ÞvÀ>ÌÌ >ÌÃÀiiÛ>ÌÌÌ i i>ÃÕÀi°/ i
Committee Chair shall inform the Authority Board Chair and Executive Director of any concern regarding Authority staff’s
commitment to open communication, the timely sharing of information, and teamwork.
The Committee shall not have the authority to set policy or appropriate or withhold funds, nor shall it participate in or
interfere with the selection process of any consultant or contractor hired to implement the expenditure plan.
The Committee shall not receive monetary compensation except for the reimbursement of travel or other incidental
expenses, in a manner consistent with other Authority advisory committees
À`iÀÌiÃÕÀiÌ >ÌÌ iÛiÀÃ} ÌLÞÌ i
ÌÌiiVÌÕiÃÌLi>ÃivviVÌÛi>ëÃÃLi]Ì iivwV>VÞvÌ i
Committee’s Charter (i.e. this document) will be evaluated on a periodic basis and a formal review will be conducted by the
ƂÕÌ ÀÌÞ >À`]
ÝiVÕÌÛi ÀiVÌÀ>`Ì i
ÌÌii>ÕviÛiÀÞwÛiÞi>ÀÃÌ`iÌiÀiv>Þ>i`iÌÃ
06-10-19 TWIC Meeting Agenda
Packet Pg.117 of 192
51ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
to this Charter should be made. The formal review will include a benchmarking of the Committee’s activities and charter
with other best-in-class oversight committees. Amendments to this Charter shall be proposed by the Committee and
adopted or rejected by the Authority Board.
The Committee replaces the Authority’s existing Citizens Advisory Committee.
Advisory Committees
The Authority will continue the committees that were established as part of the Transportation Partnership Commission
organization as well as other committees that have been utilized by the Authority to advise and assist in policy development
and implementation. The committees include:
The Regional Transportation Planning Committees that were established to develop transportation plans on a geographic
basis for sub-areas of the County, and
• The Technical Coordinating Committee that will serve as the Authority’s technical advisory committee.
• The Paratransit Coordinating Council
• The Bicycle and Pedestrian Advisory Committee
• Bus Transit Coordinating Committee
Implementing Guidelines
This Transportation Expenditure Plan (Plan) is guided by principles that ensure the revenue generated by the sales tax
ÃëiÌÞvÀÌ i«ÕÀ«ÃiÃÕÌi`Ì Ã*>Ì iÃÌivwViÌ>`ivviVÌÛi>iÀ«ÃÃLi]VÃÃÌiÌÜÌ
serving the transportation needs of Contra Costa County. The following Implementing Guidelines shall govern the
administration of sales tax revenues by the Authority. Additional detail for certain Implementing Guidelines is found
elsewhere in this Plan.
Duration of the Plan
The duration of the Plan shall be for 30 years from April 1, 2017 through March 31, 2047.
Administration of the Plan
1. Funds only Projects and Programs in the Plan: Funds collected under this Measure may only be spent for
«ÕÀ«ÃiÃ`iÌwi`Ì i*>]>ÃÌ>ÞLi>i`i`LÞÌ iƂÕÌ ÀÌÞ}ÛiÀ}L`Þ°`iÌwV>Ìv
Projects or Programs in the Plan does not ensure their implementation. As authorized, the Authority may amend
À`iiÌi*ÀiVÌÃ>`*À}À>Ã`iÌwi`Ì i*>]VÕ`}Ì«ÀÛ`ivÀÌ iÕÃiv>``Ì>vi`iÀ>]
state and local funds, to account for unexpected revenue, to maintain consistency with the current Contra
Costa Countywide Transportation Plan, to take into consideration unforeseen circumstances, and to account for
impacts, alternatives, and potential mitigation determined during review under the California Environmental
+Õ>ÌÞƂVÌ
+Ƃ®>ÌÃÕV Ìi>Ãi>V *ÀiVÌ>`*À}À>ëÀ«Ãi`vÀ>««ÀÛ>°
2. All Decisions Made in Public Process:/ iƂÕÌ ÀÌÞÃ}ÛiÌ iw`ÕV>ÀÞ`ÕÌÞv>`ÃÌiÀ}Ì i
transportation sales tax proceeds in accordance with all applicable laws and with the Plan. Activities of the
Authority will be conducted in public according to state law, through publically noticed meetings. The annual
budgets of Authority, strategic plans and annual reports will all be prepared for public review. The interest of the
06-10-19 TWIC Meeting Agenda
Packet Pg.118 of 192
52 ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
public will be further protected by a Public Oversight Committee, described previously in the Plan.
3. Salary and Administration Cost Caps: Revenues may be expended by the Authority for salaries, wages,
LiiwÌÃ]ÛiÀ i>`>`Ì ÃiÃiÀÛViÃVÕ`}VÌÀ>VÌÕ>ÃiÀÛViÃiViÃÃ>ÀÞÌ>`ÃÌiÀÌ i i>ÃÕÀiÆ
ÜiÛiÀ]V>Ãià >Ì iiÝ«i`ÌÕÀiÃvÀÌ iÃ>>ÀiÃ>`LiiwÌÃvÌ iÃÌ>vviViÃÃ>ÀÞÌ«iÀvÀ
administrative functions for the Authority exceed one half percent (0.5%) of revenues from the Measure. The
>V>Ìi`VÃÌÃvƂÕÌ ÀÌÞÃÌ>vvÜ `ÀiVÌÞ«iiÌëiVwV«ÀiVÌÃÀ«À}À>Ã>ÀiÌVÕ`i`Ì i
administrative costs.
4. Expenditure Plan Amendments Require Majority Support: The Authority may review and propose
amendments to the Expenditure Plan and the Growth Management Program to provide for the use of additional
federal, state and local funds, to account for unexpected revenues, or to take into consideration unforeseen
circumstances. Affected Regional Transportation Planning Committee(s) will participate in the development of
the proposed amendment(s). A majority of the Authority Board is required to approve an amendment and all
jurisdictions within the county will be given a 45 day period to comment on any proposed Expenditure Plan
amendment.
5. Augment Transportation Funds: Funds generated pursuant to the Measure are to be used to supplement and
not replace existing local revenues used for transportation purposes. Any funds already allocated, committed
ÀÌ iÀÜÃiVÕ`i`Ì iw>V>«>vÀ>Þ«ÀiVÌÌ i*>à >Li>`i>Û>>LivÀ«ÀiVÌ
`iÛi«iÌ>`«iiÌ>Ì>ÃÀiµÕÀi`Ì i«ÀiV̽Ãw>V>>`«iiÌ>Ì«À}À>°
6. Jurisdiction: The Authority retains sole discretion regarding interpretation, construction, and meaning of words
and phrases in the Transportation Expenditure Plan.
Taxpayer Safeguards, Audits and Accountability
7. Public Oversight Committee: The Public Oversight Committee will provide diligent, independent and public
oversight of all expenditures of Measure funds by Authority or recipient agencies (County, cities and towns,
transit operators, etc). The Committee will report to the public and focus its oversight on annual audits, the
review and allocation of Measure funds, the performance of projects and programs in the Plan, and compliance
by local jurisdictions with the maintenance of effort and Growth Management Program described previously in
the Plan
8. Fiscal Audits: All Funds expended by Authority directly and all funds allocated by formula or discretionary
}À>ÌÃÌÌ iÀiÌÌiÃ>ÀiÃÕLiVÌÌwÃV>>Õ`Ì°,iV«iÌÃv V>-ÌÀiiÌÃ >Ìi>ViE«ÀÛiiÌÃ]
Bus Transit and Other Non-Rail Transit Enhancements, or Transportation for Seniors & People With Disabilities
programs funding (including but not limited to County, cities and towns and transit operators) will be audited at
i>ÃÌViiÛiÀÞwÛix®Þi>ÀÃ]V`ÕVÌi`LÞ>`i«i`iÌ
*Ƃ°ƂÞ>}iVÞvÕ`ÌLiV«>Vi
shall have its formula sales tax funds withheld, until such time as the agency is found to be in compliance.
9. Performance Audits: The following funding categories shall be subject to performance audits by the Authority:
V>-ÌÀiiÌÃ >Ìi>Vi>`«ÀÛiiÌÃ] >À-ÌÀiiÌÃÉ
«iÌi-ÌÀiiÌÃÉ/À>vwV-}>-ÞV Àâ>Ì
Program, Bus Transit and Other Non-Rail Transit Enhancements, Transportation for Seniors and People with
Disabilities, Safe Transportation for Children, Intercity Rail and Ferry Service, Pedestrian, Bicycle, and Trail
Facilities, Community Development Transportation Program, and Innovative Transportation Technology/
Connected Communities Program. Each year, the Authority shall select and perform a focused performance
audit on two or three of the funding categories listed above, so that at the end of the fourth year all funding
categories listed above are audited. This process shall commence two years after passage of the new sales
tax measure. Additional Performance Audits shall continue on a similar cycle for the duration of the Plan. The
performance audits shall provide an accurate quantitative and qualitative evaluation of the funding categories
to determine the effectiveness in meeting the performance criteria established by the Authority. In the event
06-10-19 TWIC Meeting Agenda
Packet Pg.119 of 192
53ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
that any performance audit determines that a funding category is not meeting the performance requirements
established by the Authority, the audit shall include recommendations for corrective action including but not
limited to revisions to Authority policies or program guidelines that govern the expenditure of funds.
10. Maintenance of Effort (MOE): Funds generated by the new sales tax Measure are to be used to supplement and
not replace existing local revenues used for streets and highways purposes. The basis of the MOE requirement will
be the average of expenditures of annual discretionary funds on streets and highways, as reported to the Controller
«ÕÀÃÕ>ÌÌ-ÌÀiiÌÃ>`} Ü>ÞÃ
`i-iVÌÓ£x£vÀÌ iÌ ÀiiÃÌÀiViÌwÃV>Þi>ÀÃLivÀiÌ i«>ÃÃ>}iv
the Measure where data is available. The average dollar amount will then be increased once every three years by the
construction cost index of that third year. Penalty for non-compliance of meeting the minimum MOE is immediate
loss of all Local Streets Maintenance and Improvements funds until MOE compliance is achieved. The audit of the
"
VÌÀLÕÌà >Li>Ìi>ÃÌViiÛiÀÞwÛiÞi>ÀðƂÞ>}iVÞvÕ`ÌLiV«>Vià >LiÃÕLiVÌ
to annual audit for three years after they come back into compliance.
Any local jurisdiction wishing to adjust its maintenance of effort requirement shall submit to the Authority
a request for adjustment and the necessary documentation to justify the adjustment. The Authority staff
shall review the request and shall make a recommendation to the Authority. Taking into consideration the
recommendation, the Authority may adjust the annual average of expenditures reported pursuant to Streets and
Highways Code Section 2151. The Authority shall make an adjustment if one or more of the following conditions
exists:
£° / iV>ÕÀÃ`VÌ >ÃÕ`iÀÌ>iiÀÀi>ÀV>«Ì>«ÀiVÌÃ`ÕÀ}Ì ÃiwÃV>Þi>ÀÃ]Ì >Ì
required accumulating unrestricted revenues (i.e., revenues that are not restricted for use on streets and
} Ü>ÞÃÃÕV >Ã}iiÀ>vÕ`îÌÃÕ««ÀÌÌ i«ÀiVÌ`ÕÀ}iÀÀiwÃV>Þi>Àð
2. A source of unrestricted revenue used to support the major capital project or projects is no longer available to
the local jurisdiction and the local jurisdiction lacks authority to continue the unrestricted funding source.
3. One or more sources of unrestricted revenues that were available to the local jurisdiction is producing
iÃÃÌ >x«iÀViÌvÌ i>ÕÌ«À`ÕVi`Ì ÃiwÃV>Þi>ÀÃ]>`Ì iÀi`ÕVÌÃÌV>ÕÃi`LÞ>Þ
discretionary action of the local jurisdiction.
4. The local jurisdiction Pavement Condition Index (PCI) is 70 or greater, as calculated by the jurisdiction
Pavement Management System and reported to the Metropolitan Transportation Commission.
11. Annual Budget and Strategic Plan: Each year, the Authority will adopt an annual budget that estimates
expected sales tax receipts, other anticipated revenue and planned expenditures for the year. On a periodic
basis, the Authority will also prepare a Strategic Plan which will identify the priority for projects; the date for
project implementation based on project readiness and availability of project funding; the state, federal and
other local funding committed for project implementation, and other relevant criteria. The annual budget and
Strategic Plan will be adopted by the Authority Board at a public meeting.
12. Requirements for Fund Recipients: All recipients of funds allocated in this expenditure plan will be required to
Ã}> >ÃÌiÀ
«iÀ>ÌÛiƂ}ÀiiiÌÌ >Ì`iwiÃÀi«ÀÌ}>`>VVÕÌ>LÌÞiiiÌÃ>`>ÃÜi>ÃÌ iÀ
applicable policy requirements. All funds will be appropriated through an open and transparent public process.
13. Geographic Equity: The proposed projects and programs to be funded through the Plan constitute a
“balanced” distribution of funding allocations to each subregion in Contra Costa County. However, through
the course of the Measure, if any of the projects prove to be infeasible or cannot be implemented, the affected
subregion may request that the Authority reassign funds to another project in the same subregion, as detailed
in an Authority Fund Allocations policy, and to maintain a “balanced” distribution of funding allocations to each
subregion.
06-10-19 TWIC Meeting Agenda
Packet Pg.120 of 192
54 ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
Restrictions On Funds
14. 'ZRGPFKVWTG5JCNN$GPGƂV%QPVTC%QUVC%QWPV[: Under no circumstance may the proceeds of this
ÌÀ>ëÀÌ>ÌÃ>iÃÌ>ÝLi>««i`vÀ>Þ«ÕÀ«ÃiÌ iÀÌ >vÀÌÀ>ëÀÌ>Ì«ÀÛiiÌÃLiiwÌÌ}
residents of Contra Costa County. Under no circumstance may these funds be appropriated by the State of
>vÀ>À>ÞÌ iÀV>}ÛiÀiÌ>}iVÞ>Ã`iwi`Ì i«iiÌ}}Õ`iið
15. 'PXKTQPOGPVCN4GXKGY: All projects funded by sales tax proceeds are subject to laws and regulations of federal,
ÃÌ>Ìi]>`V>}ÛiÀiÌ]VÕ`}Ì iÀiµÕÀiiÌÃvÌ i
>vÀ>
ÛÀiÌ>+Õ>ÌÞƂVÌ
+Ƃ®°
Prior to approval or commencement of any project or program included in the Plan, all necessary environmental
ÀiÛiÜÀiµÕÀi`LÞ
+ƂÃ >LiV«iÌi`°
16. 2GTHQTOCPEGDCUGF2TQLGEV4GXKGY: Before the allocation of any measure funds for the construction of a
project with an estimated capital cost in excess of $25 million (or elements of a corridor project with an overall
estimated cost in excess of $25 million), the Authority will: 1) verify that the project is consistent with the
approved Countywide Transportation Plan (CTP), as it may be amended, 2) verify that the project is included
in the Regional Transportation Plan / Sustainable Communities Strategy, and 3) require the project sponsor to
complete a performance based review of project alternatives prior to the selection of a preferred alternative.
Said performance based review will include, but not necessarily be limited to, an analysis of the project impacts
on greenhouse gas emissions, vehicle miles travelled, goods movement effectiveness, travel mode share, delay
(by mode), safety, maintenance of the transportation system and consistency with adopted Authority plans.
/ iƂÕÌ ÀÌÞ>ÞÀiµÕÀiÌ iiÛ>Õ>ÌvÌ iÀ«iÀvÀ>ViVÀÌiÀ>`i«i`}Ì iëiVwVii`>`
purpose of the project. When appropriate, the Authority will encourage project sponsors to identify and select
a project alternative that reduces greenhouse gas emissions as well as vehicle miles travelled per capita. The
Authority will also prioritize and reward high performing projects by leveraging additional regional and other
funding sources. The Authority shall adopt detailed guidelines for evaluating project performance and applying
performance criteria in the review and selection of a preferred project alternative no later than October 1, 2018.
17. %QWPV[YKFG6TCPURQTVCVKQP2NCP: State law allows each county in the San Francisco Bay Area that is subject
to the jurisdiction of the regional transportation planning agency to prepare a Countywide Transportation Plan
(CTP) for the county and cities within the county. Both Measure C and Measure J also require the Authority to
prepare and periodically update a CTP for Contra Costa. State law also created an inter-dependent relationship
between the CTP and regional planning agency. Each CTP must consider the region’s most recently adopted
Regional Transportation Plan (RTP) and Sustainable Communities Strategy (SCS) while the adopted CTPs must
form the “primary basis” for the next RTP and SCS. The Authority shall follow applicable statutes and the most
current guidelines for preparing the CTP, as established and periodically updated by the regional transportation
planning agency. The Authority shall also use the CTP to convey the Authority’s investment priorities, consistent
with the long-range vision of the RTP and SCS.
18. %QORNGVG5VTGGVU: The Authority has adopted a policy requiring all recipients of funding through this Plan to
consider and accommodate, wherever possible, the needs of all users in the planning, design, construction,
reconstruction, rehabilitation and maintenance of the transportation system. Achieving this vision will require
balancing the needs of different users, and may require reallocating existing right of way for different uses.
19. %QORNKCPEGYKVJVJG)TQYVJ/CPCIGOGPV2TQITCO: If the Authority determines that a jurisdiction does not
comply with the requirements of the Growth Management Program, the Authority shall withhold funds and also
>i>w`}Ì >ÌÌ iÕÀÃ`VÌÃ >ÌLii}LiÌÀiViÛi V>-ÌÀiiÌÃ >Ìi>ViE«ÀÛiiÌÃÀ
Community Development Transportation Program (CDTP) funding until the Authority determines the jurisdiction
has achieved compliance, as detailed in the Growth Management Program section of the Plan.
20. .QECN%QPVTCEVKPICPF)QQF,QDU: Authority will develop a policy supporting the hiring of local contractors and
businesses, including policy requiring prevailing wages, apprenticeship programs for Contra Costa residents,
06-10-19 TWIC Meeting Agenda
Packet Pg.121 of 192
55ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
and veteran hiring policy (such as the Helmets to Hardhats program) to the extent permitted by law. The
Authority, will adopt the aforementioned policy for projects and programs funded by the measure no later than
April 1, 2018.
21. 0GY#IGPEKGU: New cities or new entities (such as new transit agencies) that come into existence in Contra
Costa County during the life of the Plan may be considered as eligible recipients of funds through a Plan
amendment.
22. %QWPV[YKFG6TCPUKV2NCP: The Authority will develop a countywide transit plan identifying services and
projects to be funded with this Measure. The plan will be inclusive of services and projects in adopted plans of
existing transit operators which have gone through a public review process prior to adoption. The plan will be
periodically reviewed and updated. Funding will be allocated by the Authority throughout the County based
on input from each Regional Transportation Planning Committee and on performance criteria established
by the Authority in consultation with local and regional bus transit operators, providers of alternate non-rail
transportation, and stakeholders. Said performance criteria will include a review of impact on Vehicle Miles
/À>Ûii`6 /®>`Àii ÕÃi>î>`à >ÀiµÕÀi>w`}Ì >Ì>Þ«À«Ãi`iÜÀi >Vi`
services demonstrate the ability to improve regional and/or local mobility for Contra Costa residents.
Project Financing Guidelines and Managing Revenue
23. (KFWEKCT[&WV[: Funds may be accumulated for larger or longer term projects. Interest income generated will be
used for the purposes outlined in the Plan and will be subject to audits.
24. 2TQLGEVCPF2TQITCO(KPCPEKPI: The Authority has the authority to bond for the purposes of expediting the
`iÛiÀÞvÌÀ>ëÀÌ>Ì«ÀiVÌÃ>`«À}À>ð/ iƂÕÌ ÀÌÞÜ`iÛi«>«VÞÌ`iÌvÞw>V}
procedures for the entire plan of projects and programs.
25. 2TQITCOOKPIQH8CTKCVKQPUHTQOVJG'ZRGEVGF4GXGPWG: Actual revenues may, at times be higher or lower
than expected in this Plan due to changes in receipts. Additional funds may become available due to the
increased opportunities for leveraging or project costs being less than expected. Revenue may be lower than
iÝ«iVÌi`>ÃÌ iiVÞyÕVÌÕ>Ìið iÌiÀ>ÌvÜ iÌ iVÌ}iVÞvÕ`ÃLiViiÝViÃÃÜLi
iÃÌ>Là i`LÞ>«VÞ`iwi`LÞÌ iƂÕÌ ÀÌÞ°Õ`ÃVÃ`iÀi`iÝViÃÃÜLi«ÀÀÌâi`wÀÃÌÌiÝ«i`ÌÕÀi
«>«ÀiVÌÃ>`«À}À>Ã]>`ÃiV`ÌÌ iÀ«ÀiVÌÃvÀi}>Ã}wV>ViÌ >Ì>ÀiVÃÃÌiÌÜÌ Ì i
expenditure plan. The new project or program will be required to be amended into the expenditure plan.
26. (WPF#NNQECVKQPU: Through the course of the Measure, if any of the projects do not require all funds
programmed for that project or have excess funding, or should a planned project become undeliverable,
infeasible or unfundable due to circumstances unforeseen at the time the expenditure plan was created, funding
for that project will be reallocated to another project or program. The subregion where the project or program is
located may request that the Authority reassign funds to another project in the same subregion. In the allocation
of the released funds, the Authority in consultation with the subregion RTPC will in priority order consider: 1)
a project or program of the same travel mode (i.e. transit, bicycle/pedestrian, or road) in the same subregion,
2) a project or program for other modes of travel in the same subregion, 3) other expenditure plan projects or
«À}À>Ã]>`{®Ì iÀ«ÀiVÌÃÀ«À}À>ÃvÀi}>Ã}wV>Vi°/ iiÜ«ÀiVÌÀ«À}À>ÀvÕ`}
level may be required to be amended into the expenditure plan.
27. .GXGTCIKPI(WPFU: Leveraging or matching of outside funding sources is strongly encouraged. Any additional
transportation sales tax revenues made available through their replacement by matching funds will be spent
based on the principles outlined for fund allocations described above.
06-10-19 TWIC Meeting Agenda
Packet Pg.122 of 192
56 ccta.net f /Contra Costa Transportation Authority T @CCTA Y ccta.net/youtube
Appendix
7! #"& F "'% #(' *&' &' &'
23 23 23 23
$ ',.&&"% "
!$%#)!"'& =::/:: ;:/>>F BB/;:?A/=B @C/AA B>/A?
(&%"& '" "!"'& "&'#"'%#&' ;;:/?? =/B>F ;;:/??
(&%"& '"' %
#"1 %"& '" "!"'& ""'% .&'"#(' *&'#"'%#&' ;B>/>: @/><F @;/>? @;/>? @;/?:
&'#"'%#&'%"& '+'"& #" A:/:: </>>F A:/::
$ ',%"& '
!$%#)!"'& #"'
1B:#%% #% ??/::;/C;F ??/::
"'% ', "%%,%)
!$%#)!"'& ?:/:: ;/A>F B/:: =?/::A/::
% #*
!$%#)!"'&5 $ ',%"& '
!$ !"'' #" #"
1@B:5<> <?:/:: B/A:F ;<?/:: ;<?/::
&'#("',#%% #%2&#"0#%,%#" *,#%% #%&3 ;;A/:: >/:AF ;;A/::
% #*
!$%#)!"'& #"<><5> ;:B/:: =/A@F >>/:: @>/::
1B:
"'% "
!$%#)!"'&'" #!#""'% )"( @:/:: </:CF @:/::
"'%&''@B:"''#('>
"'% "
!$%#)!"'& @:/:: </:CF @:/::
# '%' "'"""
!$%#)!"'& @@=/?: <=/:CF ;C;/C@ ;>A/?= ;>?/@= ;AB/=B
4 # '%' "'"""
!$%#)!"'& <:/:: :/A:F <:/::
%"&$#%'' #"#%" #%&"#$ * ' & ' & ;;?/:; >/::F =:/B: ;C/=: <B/;? =@/A@
%"&$#%'' #"#% %" @=/C@ </<=F B/A< <:/:= <@/;< C/:C
#%'%'&.#!$ ''%'&"% ," %#" -' #"%# '%"'& <C:/:: ;:/:CF ;:B/>: >@/>: ?@/@: AB/@:
&'% ". , "% ' & ;;?/:: >/::F <B/=: =:/=? <@/>; <C/C>
#!!(" ',) #$!"'%"&$#%'' #"%#%! ;::/:: =/>BF <?/<@ ;@/>? <:/:: =B/<C
""#)' )%"&$#%'' #" "# #,0#""'#!!(" ' &%"'%#%! @?/:: </<@F <</;: ;;/:: ;@/A: ;?/<:
%"&$#%'' #" "" ". ' &5%) & >=/:? ;/?:F ;</@> B/<= ;:/:< ;</;@
#" %"&$#%'' #"% #% ' & ;B/A: :/@?F ?/:: =/A: ?/:: ?/::
! " &'%' #";>/=? :/?:F >/<: </A? =/=? >/:?
$# ! ( $ % ! %!# ""$ $ #
#$( ' #"& % $# !$ $# ! %!$ ""$ $ #
#$( ' #" %2<:=:&' !'3##' % #( % ( "( $ !(
Numbers in this chart are rounded for viewing simplicity.
Table of Expenditure Plan Funding Allocations
06-10-19 TWIC Meeting Agenda
Packet Pg.123 of 192
Authority Board Special Meeting AGENDA
(Full packet with attachments available at www.ccta.net)
This meeting is scheduled to be audiocast live on the CCTA website.
Visit the Public Meetings page under “Get Involved” to tune in.
DATE: Wednesday, June 5, 2019
TIME: 6:30 p.m. (immediately following the Planning Committee regular meeting)
PLACE: Contra Costa Transportation Authority
2999 Oak Road, Suite 110
Walnut Creek, CA 94597
COMMISSIONERS Robert Taylor, Chair z Julie Pierce, Vice Chair z Janet Abelson z Newell Arnerich z Tom Butt z Teresa Gerringer z Federal Glover
Loella Haskew z David Hudson z Karen Mitchoff z Kevin Romick
ALTERNATES Candace Andersen z Juan Banales z Diane Burgis z John Gioia z David Hudson z Renee Morgan z Sue Noack z Carlyn Obringer
Renata Sos z Roy Swearingen z Sean Wright
EX-OFFICIOS Amy Worth, MTC z Debora Allen, BART z Monica Wilson, Public Transit Bus Operators
ALTERNATES Chris Kelley, Public Transit Bus Operators z Mark Foley, BART
Executive Director Randell H. Iwasaki
A. CONVENE MEETING: Robert Taylor, Chair
B. PLEDGE OF ALLEGIANCE
C. PUBLIC COMMENT: Members of the public are invited to address the Authority
regarding any item that is not listed on the agenda. Please complete one of the speaker
cards in advance of the meeting and hand it to a member of staff.
1.0 REGULAR AGENDA ITEMS:
1.1 Development of a Transportation Expenditure Plan (TEP) – Consideration of
Authority Board Meetings and Action Items and Other Key Dates. Staff seeks
approval of the proposed Authority Board TEP calendar, specifically with the
proposed additional Special Authority Board meetings of June 12, June 19, July
10, July 17, August 7, August 14, August 21, September 18, October 16, and
October 30, 2019. Staff further seeks comments on the outline of proposed
topics for the Authority Board Special meetings relative to the development of a
new TEP. Staff Contact: Timothy Haile (Attachment – Action)
06-10-19 TWIC Meeting Agenda
Packet Pg.124 of 192
Authority Board Special Meeting AGENDA
June 5, 2019
Page 2 of 3
1.2 Development of a Transportation Expenditure Plan (TEP) – Proposed Public
Information and Outreach Plan. Staff seeks approval of the proposed public
education and outreach plan. Staff Contact: Linsey Willis (Attachment – Action)
1.3 Transportation Funding and Needs. Staff will provide an overview of
transportation funding and needs in Contra Costa County. Staff Contact: Hisham
Noeimi (Attachment – Information)
1.4 Approval of the Transportation Expenditure Plan (TEP) Sales Tax Revenue
Estimate and Regional Transportation Planning Committees (RTPCs) Funding
Targets. Staff seeks direction on the tax rate and duration of a new sales tax,
which if approved by the voters, would take effect on July 1, 2020. Staff Contact:
Hisham Noeimi (Attachment – Action)
1.5 Proposed Transportation Expenditure Plan (TEP) Structure and Strategies. Staff
will discuss and seek input from the Authority Board on proposed structure and
strategies to develop a proposed Initial Draft TEP. Staff Contact: Timothy Haile
(Attachment – Action)
1.6 Discuss Initial Draft Transportation Expenditure Plan (TEP). Staff seeks
Authority Board comments regarding the framework, funding categories and
policy statements included in the proposed Initial Draft TEP. Contact: Don Tatzin
(Attachment – Action)
2.0 CORRESPONDENCE AND COMMUNICATIONS
2.1 Article from Mass Transit dated May 24, 2019 RE: CA: Sacramento kids may soon
be able to ride public transit for free (Attachment – Information)
3.0 ADJOURNMENT to a proposed special meeting on Wednesday, June 12, 2019 at 6:00
p.m.
* Footnote: In accordance with Government Code Section 84308, no Commissioner shall accept, solicit, or direct a
contribution of more than two hundred fifty dollars ($250) from any party, or his or her agent, or from any
participant, or his or her agent, while a proceeding involving a license, permit, or other entitlement for use is
pending before the agency and for three months following the date a final decision is rendered in the proceeding if
the officer knows or has reason to know that the participant has a financial interest, as that term is used in Article
1 (commencing with Section 87100) of Chapter 7. Any Commissioner who received a contribution within the
preceding 12 months in an amount of more than two hundred fifty dollars ($250) from a party or from any
participant shall disclose that fact on the record of the proceeding and the Commissioner shall not make,
participate in making, or in any way attempt to use his or her official position to influence the decision.
A party to a proceeding before the Authority shall disclose on the record of the proceeding any contribution in an
amount of more than two hundred fifty dollars ($250) made within the preceding 12 months by the party, or his or
her agent, to any Commissioner. No party, or his or her agent, shall make a contribution of more than two
hundred fifty dollars ($250) to any Commissioner during the proceeding and for three months following the date a
final decision is rendered by the agency in the proceeding. The foregoing statements are limited in their entirety by
06-10-19 TWIC Meeting Agenda
Packet Pg.125 of 192
Authority Board Special Meeting AGENDA
June 5, 2019
Page 3 of 3
the provisions of Section 84308 and parties are urged to consult with their own legal counsel regarding the
requirements of the law.
ANY WRITINGS OR DOCUMENTS pertaining to an open session item provided to a majority of the Authority less
than 72 hours prior to the meeting shall be made available for public inspection at 2999 Oak Road, Suite 100,
Walnut Creek, California, during normal business hours.
PUBLIC COMMENT: The public may comment on any matter on the agenda, or related matters not on the agenda,
by completing a speaker card (available in meeting room), which should be provided to a CCTA staff member.
Public comment may be limited to three minutes (or other such time period as determined by the Chair), in
accordance with CCTA’s Administrative Code, Section 103.4(b).
TRANSLATION SERVICES: If you require a translator to facilitate testimony to the Authority, please contact
Tarienne Grover at (925) 256-4722 no later than 48 hours in advance of the scheduled meeting. Si usted requiere
a un traductor para facilitar testimonio a la Authority, por favor llame Tarienne Grover al (925) 256-4722, 48 horas
antes de la asamblea.
ADA Compliance: This Agenda shall be made available upon request in alternative formats to persons with a
disability, as required by the Americans with Disabilities Act of 1990 (42 U.S.C. Sec. 12132) and the Ralph M. Brown
Act (Cal. Govt. Code Sec. 54954.2). Persons requesting a disability-related modification or accommodation should
contact Tarienne Grover (925-256-4722) during regular business hours, at least 24 hours prior to the time of the
meeting.
06-10-19 TWIC Meeting Agenda
Packet Pg.126 of 192
Contra Costa Transportation Authority STAFF REPORT
Meeting Date: June 5, 2019
Subject Development of a Transportation Expenditure Plan (TEP) –
Consideration of Authority Board Meetings and Action Items and
Other Key Dates
Summary of Issues At its meeting on May 15, 2019, the Authority Board approved the
guiding principles and work plan for development of a new TEP, and
directed staff to undertake activities towards development of a new TEP
that could be placed on the March 3, 2020 ballot. Staff has identified
the various steps and actions required of the Authority and its partner
agencies and stakeholders. The target date for Authority approval of a
proposed new TEP for consideration by city/town councils and the
County Board of Supervisors is August 21, 2019. The target date for
Authority approval of the final TEP and request that it be placed on the
ballot is October 30, 2019. Developing a new TEP in this timeline in a
transparent process that encourages participation by Authority partner
agencies, stakeholders and the public may require several Special
Authority Board meetings.
Recommendations Staff seeks approval of the proposed Authority Board TEP calendar,
specifically with the proposed additional Special Authority Board
meetings of June 12, June 19, July 10, July 17, August 7, August 14,
August 21, September 18, October 16, and October 30, 2019. Staff
further seeks comments on the outline of proposed topics for the
Authority Board Special meetings relative to the development of a new
TEP.
Financial Implications As previously presented, the total budget for developing a proposed
new TEP and placement on the March 2020 ballot is estimated to be
$2.95 million. The costs of additional Authority Board meetings is
included in this budget.
Options The Authority could elect to conduct business relative to the
development of a new TEP at its regularly scheduled meetings.
1.1-106-10-19 TWIC Meeting Agenda
Packet Pg.127 of 192
Contra Costa Transportation Authority STAFF REPORT
June 5, 2019
Page 2 of 3
Attachments A.Sample Schedule for Adopting a District Tax for March 2020 Election
B.Proposed Authority Board Meeting Dates and Tentative Agenda and
Action Items
Changes from
Committee
N/A
Background
At the May 15, 2019 Authority Board meeting, the Authority Board approved the guiding
principles and Work Plan for development of a new TEP, and directed staff to undertake
activities towards development of a new TEP that could be placed on the March 3, 2020 ballot.
The Work Plan outlined a process for developing and approving a new TEP to be placed on the
March 3, 2020 election, summarized with the following phases and due dates:
Phase Activities / Outcome Due Date
Authority Develops and
Approves New TEP
x Develop the “Initial Draft TEP”.
x Circulate the “Initial Draft TEP” for review
and comment by Regional Transportation
Planning Committees (RTPCs), cities/towns
and Contra Costa County, stakeholders and
public.
x Approve the final proposed new TEP and
release for consideration of approval by
cities/towns and Contra Costa County.
June 19, 2019
June 19, 2019
through
August 21, 2019
August 21, 2019
City/Town Council and
County Board of
Supervisors Review and
Approval of the new TEP
x Approval of the new TEP by a majority of
cities and towns representing a majority of
the population in the incorporated areas of
Contra Costa County.
x Approval of the new TEP by the County
Board of Supervisors.
October 21, 2019
October 22, 2019
Authority Board Adopts
Ordinance and Resolution
Adopt ordinance to approve final TEP, tax
ordinance and resolution authorizing
placement of tax measure on the ballot and
October 30, 2019
1.1-206-10-19 TWIC Meeting Agenda
Packet Pg.128 of 192
Contra Costa Transportation Authority STAFF REPORT
June 5, 2019
Page 3 of 3
requesting the County Board of Supervisors to
place the final TEP on the March 3, 2020 ballot.
County Board of
Supervisors Approves
Ordinance to Place the
Final TEP on Ballot
Ordinance to consolidate special election on
Authority Board tax measure for the March 3,
2020 statewide election.
November 19, 2019
County Board of
Supervisors Consolidates
the Election
Last day to place a measure on the ballot. December 6, 2019
ELECTION DAY March 3, 2020
A more detailed sequence of activities with the reference to the authorizing California Code
section is included in Attachment A, Sample Schedule for Adopting a District Tax for the March
3, 2020 election.
As authorized at the May 15, 2019 Authority Board meeting, Authority staff will conduct public
and stakeholder outreach efforts and seek input from RTPCs, cities/towns and the Contra Costa
County elected officials and staff, other partner agencies, stakeholders, and the public
throughout the process leading to the Authority Board’s consideration on October 30, 2019 to
approve the new TEP. The Authority Board has determined that it would like to approve the
new TEP as a “committee of the whole”. Currently, the Authority Board only has its regularly
scheduled monthly board meetings. Staff believes that additional Authority Board meetings are
warranted to achieve a transparent process to engage all interested parties, and one that
allows the Authority Board to receive reports of all input received, hear additional testimony
from interested parties, and to deliberate and provide staff with necessary direction on
developing the various sections of the new TEP.
A proposed schedule of Authority Board special meeting dates and potential topics and action
items for each meeting is included in Attachment B. Additional Special Authority Board
meetings may be required pending the discussion and outcomes of the proposed meetings.
Staff seeks approval of the proposed Authority Board TEP calendar, specifically with the
proposed additional Special Authority meetings of June 12, June 19, July 10, July 17, August 7,
August 14, August 21, September 18, October 16, and October 30, 2019. Staff further seeks
comments on the proposed meeting dates and outline of proposed topics for the Authority
Board Special meetings relative to the development of a new TEP.
1.1-306-10-19 TWIC Meeting Agenda
Packet Pg.129 of 192
CONTRA COSTA TRANSPORTATION AUTHORITY
SAMPLE SCHEDULE FOR ADOPTING A DISTRICT TAX
Pub. Util. Code, § 180200 et seq.
Rev. & Tax. Code, § 7251 et seq.
MARCH 2020 ELECTION – MARCH 3, 2020
Deadline to Consolidate Election (place Measure on Ballot) –
December 6, 2019 (88 days prior to Election)
Agency Action Timing (legal authority)
APPROVE TRANSPORTATION EXPENDITURE PLAN
Authority Prepare Transportation Expenditure Plan
(TEP)
Mid-April – Mid-August, 2019
(Pub. Util. Code, 實 180201,
180206.)
Authority Approve proposed TEP. Circulate
proposed TEP to cities/towns and County
Board of Supervisors for approval.
August 21, 2019
SPECIAL MEETING
(Pub. Util. Code, 實 180206(b),
(c).)
Cities/Towns/
Public
Majority of cities/towns councils and
city/town councils representing a
majority of the population in the
incorporated areas of Contra Costa
County approve the TEP.
Public review
September/Mid-October, 2019
(Pub. Util. Code, 實 180206(b),
(c).)
County Board
of Supervisors
Approves the TEP. October 22, 2019
(Pub. Util. Code, 實 180206(b),
(c).)
Authority Adopt Ordinance to approve the TEP. October 30, 2019
dd,D Ed
1.1-506-10-19 TWIC Meeting Agenda
Packet Pg.130 of 192
Agency Action Timing (legal authority)
After receiving approval from the County
Board of Supervisors and a majority of
cities/towns and cities/towns
representing a majority of the
population in the incorporated areas of
Contra Costa County, it can be adopted
at the same meeting where the tax
ordinance is adopted and the request to
call and consolidate the election is made,
however, it must be approved first. (Pub.
Util. Code, 實 180206(b).)
SPECIAL MEETING
(Pub. Util. Code, 實 180206(b).)
ADOPT TAX ORDINANCE AND CALL ELECTION – MARCH 2020
Authority Adopts tax ordinance by 2/3 vote;
Adopts resolution (i) authorizing
placement of tax measure on the ballot;
(ii) directing the Attorney to prepare an
impartial analysis of the ballot measure;
(iii) consolidating the election with the
general election; and (iv) requesting the
County Board of Supervisors to permit
the County Elections Official to render
specified services for the conduct of the
election, including preparation of the
election materials.
October 30, 2019
SPECIAL MEETING
(Pub. Util. Code, 實 180201; Elec.
Code, 實 10403.)
Authority Clerk files with the County Board of
Supervisors the resolution consolidating
the election with a general election OR
calling the special election, requesting
election services, and setting forth the
exact form of the proposition as it is to
appear on the ballot.
October 31, 2019
1.1-606-10-19 TWIC Meeting Agenda
Packet Pg.131 of 192
Agency Action Timing (legal authority)
County Board
of Supervisors
Introduce County Ordinance to call and
consolidate the special election on the
Authority’s tax measure with the March
3, 2020 statewide special election.
November 12, 2019
(Gov Code 實25131; Pub. Util.
Code, 實 180201)
County Board
of Supervisors
Adopts County Ordinance. November 19, 2019
(Gov Code 實25131)
County Board
of Supervisors
Consolidates election. December 6, 2019
The ballot proposition must be
submitted not less than 88 days
prior to the date of the election.
(Elec. Code, § 10403(a))
Voters Voters consider district tax. March 3, 2020
First Tuesday after the first
Monday in November.
(Elec. Code, 實 1000(d).)
1.1-706-10-19 TWIC Meeting Agenda
Packet Pg.132 of 192
Attachment B
Development of a New Transportation Expenditure Plan (TEP)
Proposed Contra Costa Transportation Authority (Authority) Board Meeting Dates and
Tentative Agenda and Action Items
_____________________________________________________________________________
June 5, 2019
Special Authority Board Meeting
Proposed Agenda
1. The TEP Development and Schedule
Staff seeks approval of the proposed Authority Board TEP calendar, specifically with the
proposed additional Special Authority Board Meetings of June 12, June 19, July 10, July
17, August 7, August 21, September 18, October 16 and October 30, 2019.
2. Proposed Public Information and Outreach Plan
Staff will provide an overview of the proposed Outreach Plan for partner agencies,
stakeholders and the public.
3. Transportation Funding and Needs
Staff will provide the Authority Board with a summary of transportation needs for
projects and programs based on current needs and forecast documented in the 2017
Countywide Transportation Plan (CTP) and Regional Transportation Plan (RTP), and a
summary and discussion of the impacts of recently approved new transportation
funding including Regional Measure 3 (RM3) and Senate Bill 1 (SB1) passed in 2018.
4. Approval of the Transportation Expenditure Plan (TEP) Sales Tax Revenue Estimate and
Regional Transportation Planning Committee (RTPC) Funding Targets
Staff seeks approval of the revenue forecast, tax rate and term for preparation of a new
proposed TEP.
5. Proposed TEP Strategies
Staff seeks comments of proposed TEP structure and strategies to develop an Initial
Draft TEP.
1.1-9
dd,D Ed
06-10-19 TWIC Meeting Agenda
Packet Pg.133 of 192
6. Discuss Initial Draft TEP
Staff will present an initial draft of project/program funding categories and possible
funding amounts, and will outline the major policies contained in the 2016 TEP. Staff will
outline potential changes to be considered from the 2016 TEP policies for an Initial Draft
TEP. Staff seeks comments and direction on funding categories and potential policy
changes.
_____________________________________________________________________________
June 12, 2019
Special Authority Board Meeting
Proposed Agenda
1. Discuss Performance Measures and Authorize Performance Analysis of the TEP
Staff will propose a set of performance measures that measure the TEP benefits
included in the guiding principles. Staff recommends starting the performance analysis
based on the Initial Draft TEP and to update and complete final performance analysis
using the TEP to be approved on August 21, 2019. Staff seeks input from Authority
Board of outcome-based performance analysis of the TEP.
2. Discuss Initial Draft TEP, Project/Program Categories and Funding Amounts
Staff will provide an overview of proposed additional changes made to the initial draft of
project/program funding categories and amounts based on Authority Board direction
and from stakeholder input. Staff seeks comments and direction for possible additional
changes to be considered in the Initial Draft TEP.
3. Discuss Proposed Policies to be Considered for a New TEP
Staff will provide an overview of the policies and an outline of proposed changes in
policies to be included in the Initial Draft TEP based on Authority Board direction and
stakeholder input. Staff seeks comments and direction for possible additional changes
to be considered in the Initial Draft TEP.
_____________________________________________________________________________
1.1-1006-10-19 TWIC Meeting Agenda
Packet Pg.134 of 192
June 19, 2019
Special Authority Board Meeting
Proposed Agenda
1. Discuss Initial Draft TEP, Project/Program Categories and Funding Amounts
Based on comments received at the June 12, 2019 Authority Board meeting, staff will
provide an overview of proposed changes made to the initial draft of project/program
funding categories and amounts based on Authority Board direction and from
stakeholder input. Staff seeks comments and direction for possible additional changes
to be considered in the Initial Draft TEP.
2. Discuss Proposed Policies to be Contained in the Initial Draft TEP
Based on comments received at the June 12, 2019 Authority Board meeting, staff will
provide an overview of the policies and an outline of proposed changes in the policies to
be included in the Initial Draft TEP. Staff seeks comments and direction for possible
additional changes to be considered in the Initial Draft TEP.
3. Approve Performance Measures and Authorize Performance Analysis of the TEP
Based on feedback received at the June 12, 2019 Authority Board meeting, staff will
recommend a set of performance measures that measure the TEP benefits included in
the guiding principles. Staff recommends starting the performance analysis based on the
Initial Draft TEP and to update and complete final performance analysis using the TEP to
be approved on August 21, 2019. Staff seeks Authority Board approval of outcome-
based performance analysis of the Initial Draft TEP.
4. Authorization to Release Initial Draft TEP for Comments
Staff will provide a summary of next steps and seek Authority Board authorization to
release the Initial Draft TEP for review and comment. Staff recommends that interested
parties provide comment prior to the proposed Special Authority Board meeting on
August 7, 2019.
_____________________________________________________________________________
1.1-1106-10-19 TWIC Meeting Agenda
Packet Pg.135 of 192
July 10, 2019
Special Authority Board Meeting (if needed)
Proposed Agenda
1. Discuss Proposed Policies to be Contained in the Final TEP
Based on comments received at the June 19, 2019 Authority Board meeting and input
from stakeholders, staff will provide an overview of the policies and an outline of
proposed changes in the policies to be included in the Final TEP. Staff seeks comments
and direction on potential policy changes.
____________________________________________________________________________
July 17, 2019
Special Authority Board Meeting
Proposed Agenda
1. Discuss Feedback Received to Date on the Initial Draft TEP
Staff will provide an overview of feedback received to date and provide the draft
schedule for the Authority Board meetings in August to consider all comments and
approve the TEP.
2. Discuss Possible Changes to be Included in the Final TEP
Staff will outline a series of possible changes to be made to the Initial Draft TEP, and
seek Authority Board comments and direction regarding proposed changes.
____________________________________________________________________________
August 7, 2019
Special Authority Board Meeting
Proposed Agenda
1. Summary of Feedback Received from RTPCs, Cities/Towns/PMA, Stakeholders, and
Public
Staff will provide summary of feedback received regarding the Initial Draft TEP.
2. Discuss Final TEP, Project/Program Categories and Funding Amounts
1.1-1206-10-19 TWIC Meeting Agenda
Packet Pg.136 of 192
Base on comments received on the Initial Draft TEP, staff will provide an overview of
proposed changes of project/program funding categories and amounts based on
feedback received from RTPCs, cities/towns/Public Managers Association (PMA),
stakeholders and public. Staff seeks comments and direction for possible additional
changes to be considered in the Final TEP.
3. Discuss Proposed Policies to be Contained in the Final TEP
Based on comments received on the Initial Draft TEP, staff will provide an overview of
the policies and an outline of proposed changes in the policies to be included in the
Final TEP. Staff seeks comments and direction for possible additional changes to be
considered in the Final TEP.
4. Approval of Final TEP Format
Staff will provide a proposed Final TEP format and seek Authority Board approval.
____________________________________________________________________________
August 14, 2019
Special Authority Board Meeting (if needed)
Proposed Agenda
1. Discuss Additional Feedback Received on Initial Draft TEP
Staff will provide a summary of feedback received to date, and any additional feedback
received based on discussions from the August 7, 2019 Authority Board meeting.
2. Discuss Final TEP, Project/Program Categories and Funding Amounts
Based on comments received by the Authority Board and additional feedback on the
Initial Draft TEP, staff will provide an overview of proposed changes of project/program
funding categories and amounts. Staff seeks comments and direction for possible
additional changes to be considered in the Final TEP.
3. Discuss Proposed Policies to be Contained in the Final TEP
Based on comments received by the Authority Board and additional feedback on the
Initial Draft TEP, staff will provide an overview of the policies and an outline of proposed
changes in policies to be included in the Final TEP. Staff seeks comments and direction
for possible additional changes to be considered in the Final TEP.
____________________________________________________________________________
1.1-1306-10-19 TWIC Meeting Agenda
Packet Pg.137 of 192
August 21, 2019
Special Authority Board Meeting
Proposed Agenda
1. Authority Approves Proposed TEP
Based on comments received, staff will provide an overview of the final project/program
funding categories and amounts, and final policies to be considered by the Authority
Board. Staff seeks approval of the proposed Final TEP and authorization for circulation to
cities/towns and county for approval.
2. Schedule for Approval of the TEP by Cities/Towns and County Board of Supervisors
Staff will provide an overview of the proposed meeting dates of each of the cities/towns,
and County Board of Supervisors for consideration to approve the Final TEP.
____________________________________________________________________________
September 18, 2019
Special Authority Board Meeting
Proposed Agenda
1. Provide Update on Status of TEP Approval
2. Provide Update on Performance Analysis
____________________________________________________________________________
October 16, 2019
Special Authority Board Meeting
Proposed Agenda
1. Provide Update on Status of TEP Approval
2. Draft Ordinance Approving TEP, Tax Ordinance and Resolution asking the County Board of
Supervisors to Call the Election
Staff and Authority Counsel will discuss the draft ordinance approving the TEP, tax
ordinance, and resolution.
____________________________________________________________________________
1.1-1406-10-19 TWIC Meeting Agenda
Packet Pg.138 of 192
October 30, 2019
Special Authority Board Meeting
Proposed Agenda
1. Authority Board Adopts Ordinance Approving TEP, Adopts Tax Ordinance, and Resolution
asking the County Board of Supervisors to Call the Election
1.1-1506-10-19 TWIC Meeting Agenda
Packet Pg.139 of 192
Contra Costa Transportation Authority STAFF REPORT
Meeting Date: June 5, 2019
Subject Development of a Transportation Expenditure Plan (TEP) – Proposed
Public Information and Outreach Plan
Summary of Issues At this time, the Authority Board has indicated that a TEP may be placed
before voters in March 2020, and has directed staff to proceed with
development of a plan. Staff has prepared a draft plan for public
education and outreach activities designed to lay the groundwork for an
inclusive process for the preparation of the TEP.
Recommendations Staff seeks approval of the proposed public education and outreach
plan.
Financial Implications The proposed public information and outreach plan outlines how the
$700,000, approved by the Authority Board at the May 15, 2019
meeting, for outreach and communication activities related to
development of a new TEP will be expended.
Options 1.Modify the proposed public education and outreach plan.
2.Defer action to a later time.
Attachments A.Proposed Public Information and Outreach Plan
Changes from
Committee
N/A
Background
The Authority Board has signaled its intention to place a TEP before the voters in March 2020,
kicking off public education and discussion about the future of transportation in Contra Costa
County. This is a great opportunity to inform and engage the public about past, present and
future transportation investments in Contra Costa County, and ensure that residents have the
opportunity to provide input on a TEP this summer. The attached Draft Public Education and
Outreach Plan (Attachment A) is a high-level overview designed to provide a framework for a
public information and outreach effort this calendar year.
1.2-106-10-19 TWIC Meeting Agenda
Packet Pg.140 of 192
CONTRA COSTA TRANSPORTATION AUTHORITY
PROPOSED PUBLIC INFORMATION AND OUTREACH PLAN
SUMMER 2019
INTRODUCTION
With the Contra Costa Transportation Authority (Authority) embarking upon development of a
new Transportation Expenditure Plan (TEP), the Authority is excited to engage with residents
about the future of transportation in Contra Costa County.
A TEP is an investment plan for the future, designed to ensure that local sales tax dollars are
invested in alignment with the priorities of Contra Costa County’s diverse residents and
businesses. More specifically, the TEP outlines a suite of cohesive projects and multi-
dimensional solutions that support smart transportation planning and development in Contra
Costa County, and enables the county to leverage state and federal funding sources to deliver
those improvements to the public.
The Authority intends to release a first draft of a TEP to the public in June 2019 for input, with a
goal of incorporating public and stakeholder feedback into a final draft completed by
September 2019. This provides approximately three months to execute an outreach and
engagement strategy.
TRANSPORTATION EXPENDITURE PLAN (TEP) OUTREACH TOOLS
There are many stakeholder groups involved in the development and feedback required to
assemble a final draft version of the TEP including, but not limited to: the public that the
Authority serves; the Regional Transportation Planning Committees (RTPCs) – and by extension
the county, and cities/towns that are represented on the committees; advocacy organizations,
elected officials, and partner agencies.
Authority staff has begun the process of engaging the RTPCs to solicit input and feedback on a
potential TEP, and that process will continue throughout the summer. Through Don Tatzin, the
Authority has also begun the process of reaching out directly to advocacy and community
organizations and partner agencies to inform them of the Authority’s intention to move
forward with developing a new TEP. The activities and tools outlined below are intended to
help solicit input directly from the public.
The Authority Board anticipates releasing a draft TEP to the public at its June 19, 2019 Authority
Board meeting. At the September Authority Board meeting, the final draft TEP will be adopted
and distributed to cities/towns for approval. Staff proposes using the tools shown in the table
below to amplify the Authority’s community engagement and education efforts. Throughout
the outreach process, staff will carefully track performance metrics of the activities proposed so
dd,D Ed
1.2-306-10-19 TWIC Meeting Agenda
Packet Pg.141 of 192
that staff can make any necessary adjustments, and provide a summary report at the
conclusion of this outreach period.
Staff proposes the following outreach activities to solicit direct input from the public on a draft
TEP:
x Telephone Town Halls
This tool provides an opportunity for the public to participate via telephone from a
location they prefer to learn about the draft TEP, ask questions, and answer in-call polls.
Calls will be recorded and both an audio file and written transcription will be available
on the Authority’s website. Staff proposes to host one town hall in partnership with
each RTPC in the county, and potentially one additional countywide telephone town
hall, schedule-permitting.
x Community Meetings
Staff is proposing to host a minimum of one in-person community meeting in each
subregion of the county. The goal is to co-host these meetings with local community-
based-organizations to extend the Authority’s outreach deeper into communities that
might not normally attend a public meeting. We will try to exceed the number of
proposed community meetings to the extent time and budget allow.
x Online Engagement Survey or Tool; Potential Companion Printed Survey
Staff will develop an option for residents to share their feedback online, providing a
forum for residents to communicate their views on the draft TEP. The plan is to also
create a non-electronic option as a companion to the online survey or tool for
distribution to public spaces and at public events to aid in obtaining the public’s point of
view.
x Development and Distribution of Informational Materials
The draft TEP is a blueprint for the future of transportation in Contra Costa County and
details strategies, projects and programs. Since the draft TEP will likely be a
comprehensive document, a suite of supplemental materials will be developed to share
information about proposed investments. For example, fact sheets may be created for
each city, town and the County. Presentations may be developed that can be given by
staff and Commissioners upon request. Newsletter articles, videos, postcards, and blog
posts about the draft TEP are also examples of the types of materials that may be
created.
x Media Engagement Across a Variety of Platforms and Channels
1.2-406-10-19 TWIC Meeting Agenda
Packet Pg.142 of 192
Today’s media landscape includes a plethora of opportunities to reach the public
utilizing traditional, digital and social media platforms. Strategies for soliciting public
feedback on the draft TEP could include hosting information sessions for members of
the media, paid media, and tools like Reddit’s “Ask Me Anything”.
x Updating the Authority’s Communication Channels
One of our key tools for informing the public about the draft TEP will be a dedicated
web page we create on the Authority’s website (www.ccta.net) that can serve as a hub
of information about the TEP development process. The Authority has other
communication channels (social media, e-newsletter, etc.) it can also use to provide
regular updates to the public about the TEP development process.
x Presentations
Continue the Authority’s longstanding tradition of speaking upon request to interested
community groups and proactively reach out to community organizations with an offer
to provide a presentation on the Authority’s work and the draft TEP.
x In-person Public Comment
One of the most direct ways for the Authority Board to hear from the public is to ensure
that the public is aware of the opportunity for in-person public comment at each of the
Authority’s Board meetings. Staff will ensure this option is always presented to the
public through the tools and mediums outlined above.
TRANSPORTATION EXPENDITURE PLAN OUTREACH BUDGET
Activity Category Cost
Development of the Draft TEP document
This portion of the budget is allocated to the development and production
of the actual TEP document itself, including creation of a new document
(and updates of the document for Authority Board meetings this summer)
that includes substantial work on new text, graphics, maps and
photography. Should the Authority move forward with placing a measure
on the ballot, this line item in the budget also includes formatting the
document for the ballot, including Spanish and Chinese translations.
$230,000.00
Telephone Town Halls
Budget is for 5 telephone town halls. Each town hall will be simulcast in
Spanish. Audio recordings and written transcriptions will be done for each
town hall. Budget figure also includes costs to purchase a list of phone
numbers, invite participants in advance via telephone calls and texts,
$125,000.00
1.2-506-10-19 TWIC Meeting Agenda
Packet Pg.143 of 192
outbound dialing to approximately 25,000 residents per each call, and
advertising the telephone town hall to community members in each RTPC.
Community Meetings & Events
Budget includes potential costs for meeting spaces, food, audio/visual,
and other items that may vary by meeting partner, as well as budget to
leverage summer events already scheduled (parades, festivals, etc.) to
share information and survey materials with members of the public.
$60,000.00
Online Engagement Tool/Survey and Companion Printed Survey
Includes development costs for online tool/survey and printing costs.
$70,000.00
Informational Materials and Media Engagement
Cost estimate is intended to cover any development costs, printing costs,
or media purchases.
$200,000.00
Updating the Authority’s Communication Channels $15,000.00
TOTAL $700,000.00
ADDITIONAL COMMUNICATION ACTIVITIES
The communications activities outlined above are designed to engage the public in a dialogue
about the draft TEP and future of transportation in Contra Costa County. Concurrent with this
effort, the Authority will continue to refine the agency’s brand identity and develop
communications that help tell our story to the public.
RECOMMENDATION
Staff recommends approval of the proposed public information and outreach plan.
1.2-606-10-19 TWIC Meeting Agenda
Packet Pg.144 of 192
Contra Costa Transportation Authority STAFF REPORT
Meeting Date: June 5, 2019
Subject Transportation Funding and Needs
Summary of Issues Despite the passage of Senate Bill 1 (SB1) and Regional Measure 3
(RM3) in the past two years, the need for local funding still exists in
Contra Costa County to be able to provide the required matched
funding to access these sources of new funding. Out of $2.4 billion in
additional funding needed to complete a number of high priority
projects aimed to reduce congestion, improve safety and provide
mobility options along congested corridors, staff estimates that $1.6
billion will need to come from new funding sources. Furthermore,
additional funding is still needed for local streets pavement
maintenance, completion of the County’s bike and pedestrian network,
and enhancing transit services.
A new local fund source will not only help address some of those needs,
but will also ensure that Contra Costa County is well positioned to
attract State and federal funds that would otherwise go to other
counties that are able to provide the required match for these sources.
Recommendations N/A – Information Only
Financial Implications N/A – Information Only
Options N/A
Attachments A.Capital Projects with Funding Shortfalls
B.Metropolitan Transportation Commission (MTC) StreetSaver
Analysis of 10-year Pavement Condition
Changes from
Committee
N/A
Background
Measure J, which extended the countywide transportation half-percent sales tax, was passed
by Contra Costa County voters in November 2004. The 25-year Measure J became effective on
1.3-106-10-19 TWIC Meeting Agenda
Packet Pg.145 of 192
Contra Costa Transportation Authority STAFF REPORT
June 5, 2019
Page 2 of 8
April 1, 2009 and will expire in 2034. With the passage of Measure J, the Contra Costa
Transportation Authority (Authority) embarked on a three-pronged strategy to deliver Measure
J capital projects years ahead of when otherwise would have been possible. The strategy
consisted of advancing project funding by issuing bonds against a portion of future Measure J
funds, getting projects shovel-ready, and partnering with other agencies to leverage Measure J
funds. This allowed the Authority to take advantage of low interest rates, a favorable
construction climate during the great recession, and one-time infusion of State and federal
funds, such as Proposition 1B in 2006 and Federal Stimulus funding in 2008.
At this time, two-thirds of Measure J capital projects are complete or under construction, 14
years ahead of when Measure J expires (in 2034). Early delivery of projects not only allows
providing benefits to the public sooner than otherwise possible but it also provides a better
return on investment as costs escalate over time.
Completed Measure J projects include the Caldecott 4th bore, State Route 4 (SR4) widening,
East Bay Area Rapid Transit (eBART) extension to Antioch, Interstate 80 (I-80) Smart Corridor, I-
80/San Pablo Dam Road – phase 1, Balfour Road Interchange, Sand Creek Interchange, and
others. Major projects currently under construction include I-680/SR4 – phase 3, I-680
Southbound (SB) High Occupancy Vehicle (HOV) and Express Lane, and Kirker Pass Truck
Climbing Lane.
The Authority’s pursuit of State and federal transportation funding has historically allowed it to
leverage its limited Measure J funds at a rate of 3 to 1. Without Measure J, the Authority would
not have been able to compete for many grants and programs, resulting in delayed project
delivery and significant lack of transportation infrastructure in Contra Costa County.
New Transportation Revenues
Senate Bill 1 (SB1)
The transportation funding landscape in the Bay Area has improved in the past couple of years
with the passage of SB1 and RM3. Both measures helped reverse the trend of eroding
investments in California’s transportation system. SB1 – The Road Repair and Accountability Act
was passed by the legislature and signed by the Governor in 2017. It increased gas taxes and
added vehicle registration fees to raise $5 billion statewide annually in new transportation
revenues. SB1 also provides for inflationary adjustments so that the purchasing power does not
diminish as it has in the past. SB1 prioritizes maintenance and rehabilitation of local streets and
safety improvements, where $3 billion out of $5 billion is set aside equally between the local
jurisdictions (cities/towns/counties) and the State for such purposes. With $1.5 billion in SB1
1.3-206-10-19 TWIC Meeting Agenda
Packet Pg.146 of 192
Contra Costa Transportation Authority STAFF REPORT
June 5, 2019
Page 3 of 8
funds now flowing to the cities/towns/counties in California, Contra Costa County jurisdictions
are expected to receive approximately $31 million in Fiscal Year (FY) 2018-19, compared to
about $16 million from Measure J local streets maintenance funds. For larger cities, SB1
provides a larger amount of funding than what Measure J provides for local street
maintenance. For medium and smaller cities, the amount provided by SB1 is equivalent to what
the jurisdictions currently receive from Measure J. Table 1 provides a breakdown of funding by
jurisdiction for local streets and roads from various current sources.
Table 1: Local Streets and Roads SB1 and Measure J Funding by Jurisdictions
City League of California
Cities Highway
Users Tax Account
(HUTA) (Gas Tax)
Estimate
(FY 2018-19)
League of California
Cities Estimates for
SB 1 Funding
(FY 2018-19)
18% Return to
Source - Measure J
Estimate
(FY 2018-19)
Antioch
$ 2,286,160 $ 1,920,309 $ 1,324,213
Brentwood $ 1,278,794 $ 1,070,751 $ 976,335
Clayton
$ 237,445 $ 194,153 $ 263,217
Concord $ 2,609,564 $ 2,193,729 $ 1,657,497
County $ 19,979,204 $ 14,575,115 $ 2,673,163
Danville $ 902,702 $ 754,054 $ 702,083
El Cerrito
$ 510,817 $ 423,582 $ 426,067
Hercules $ 539,500 $ 446,987 $ 397,166
Lafayette
$ 526,201 $ 435,743 $ 464,965
Martinez $ 776,157 $ 647,067 $ 585,811
Moraga
$ 350,144 $ 288,588 $ 334,646
Oakley $ 849,384 $ 708,976 $ 621,548
Orinda
$ 394,502 $ 326,090 $ 430,064
Pinole $ 395,245 $ 326,719 $ 340,302
Pittsburg $ 1,471,756 $ 1,233,889 $ 871,221
Pleasant Hill $ 715,305 $ 595,620 $ 600,067
Richmond
$ 2,244,092 $ 1,884,743 $ 1,389,301
San Pablo $ 645,494 $ 536,599 $ 404,564
San Ramon $ 1,672,572 $ 1,403,668 $ 948,903
Walnut Creek $ 1,431,978 $ 1,200,259 $ 986,866
$ 39,817,016 $ 31,166,641 $ 16,397,999
1.3-306-10-19 TWIC Meeting Agenda
Packet Pg.147 of 192
Contra Costa Transportation Authority STAFF REPORT
June 5, 2019
Page 4 of 8
In addition, SB1 provides additional funding to transit agencies. Table 2 provides a comparison
of funding from various sources including Measure J and SB1 by transit agency, as estimated by
MTC.
Table 2: SB1 and Measure J Funding by Transit Agency
Transit
Agency
Baseline
STA*
Funding
(FY 2016-17
Estimate)
MTC
estimates of
Net Increase
in STA funding
from SB1
(FY 2018-19)
MTC estimates
of Annual
Transit Capital
funding via STA
Formula in SB1
(FY 2017-18)
Measure J
Program 4
Bus Services
(5%)
(FY 2018-19)
Measure J
Program 16
Bus Services
(4.3%)
(FY 2018-19)
Measure J –
Program
19b West
Co. Add’l
Bus Service
(2.16%)
(FY 2018-19)
AC Transit $6,938,750 $6,494,389 $2,727,643 $1,797,978 $1,437,754 $1,608,360
Tri Delta $202,949 $189,952 $79,780 $359,596 $269,579 --
County
Connection
$438,211 $410,147 $172,262 $1,797,978 $1,797,192 --
WestCAT $229,652 $214,945 $90,277 $539,393 $359,439 $369,657
WETA $943,358 $882,945 $370,637 -- -- --
BART $18,963,775 $14,920,667 $6,266,680 -- -- --
TOTAL $27,716,695 $23,113,045 $9,707,279 $4,494,945 $3,863,964 $1,978,017
* STA: State Transit Assistance
SB1 also provides $100 million per year in funding (available on a competitive basis) for
pedestrian and bicycle facilities through the Active Transportation Program (ATP). Several other
competitive categories in SB1 have restrictions on types of projects eligible (e.g. freight-related
projects) and who can apply. In most cases, matching funds are either required or used as a
factor to determine priority. The Authority was successful in securing $33.6 million for I-
680/SR4 - Phase 3 from one of those competitive categories (Local Partnership Program (LPP)
funds) but a one-to-one match was required. The Authority would not have been able to
compete for this fund source if Contra Costa voters did not approve Measure J in 2004, as it
would likely not have the required matching funds.
Finally, as a reward for being a self-help county and passing Measure J in 2004, the Authority
started receiving about $2.3 million per year from the Formulaic portion of the LPP in SB1 to
invest in the transportation system, which is a fraction of the $90.8 million generated by
Measure J in FY 2017-18. The formulaic LPP funds of $2.3 million per year is the only funding
from SB1 that the Authority receives without having to compete.
1.3-406-10-19 TWIC Meeting Agenda
Packet Pg.148 of 192
Contra Costa Transportation Authority STAFF REPORT
June 5, 2019
Page 5 of 8
Regional Measure 3 (RM3)
In 2018, Bay Area approved RM3, which increases the tolls on all Bay Area bridges except for
the Golden Gate Bridge. The tolls increased by $1 in 2019, an additional $1 in 2022, and an
additional $1 in 2025, for a total increase of $3. After 2025, the legislation allows tolls to be
increased to keep up with inflation.
Several projects in Contra Costa County were included in the RM3 project list, totaling $360
million in funding, as follows:
x I-680/SR 4 Interchange Improvements ($210,000,000)
x Richmond-San Rafael Bridge Access East Side Improvements ($75,000,000)
x I-80 Transit Improvements ($25,000,000)
x Byron Highway – Vasco Road Airport Connector ($10,000,000)
x East Contra Costa County Transit Intermodal Center ($15,000,000)
x I-680 Transit Improvements ($10,000,000)
The infusion of RM3 funding in the above projects will bring them closer to reality but
unfortunately does not fully fund any of them. Many other priority projects in Contra Costa
County are not on the list.
In addition, RM3 provided $500 million for additional BART cars, and had several categories
(e.g. Express Lanes) that could provide funding to other projects in Contra Costa if matching
funding or full funding plans can be demonstrated.
Measure RR
In 2016, residents of San Francisco, Alameda and Contra Costa Counties voted on Measure RR.
The approved measure provides additional funding to BART for track improvements and
modernization of the train control system. It also set aside $135 million for access
improvements at BART stations. At this time, no definitive list of specific projects in Contra
Costa County is available.
Unmet Transportation Needs
Despite the passage of SB1, RM3, and Measure RR in the past two years, the need for local
funding still exists in Contra Costa County. The lack of transportation investment in the past has
created significant backlogs of deferred maintenance on the local system. In addition, added
requirements (e.g. clean water), and higher labor and material costs are contributing to
1.3-506-10-19 TWIC Meeting Agenda
Packet Pg.149 of 192
Contra Costa Transportation Authority STAFF REPORT
June 5, 2019
Page 6 of 8
climbing construction costs. Increases in population and employment have added additional
demand on an already stressed transportation system.
The ongoing effort by the Authority to update the project list as part of the new Regional
Transportation Plan (RTP) reveals a need in excess of $7.5 billion in funding over the 30-year
RTP period, of which only $3.3 billion is expected to be available from existing sources. The list
below demonstrates some of the unmet transportation needs in Contra Costa County.
Major Capital Projects Need: Attachment A lists the funding plans for a select group of major
capital projects in Contra Costa County, taking into consideration recently passed funding
initiatives and measures. These projects are aimed to reduce congestion, improve safety, and
provide mobility options to commuters. Approximately $2.4 billion in funding is still needed in
spite of the additional funding available from SB1 and RM3. Staff estimates that $800 million
may become available over the remaining life of Measure J from current federal, State and
regional fund sources if the Authority is successful in competing and has the required matching
funds. This additional $800 million would reduce the shortfall from $2.4 billion to $1.6 billion. A
summary is provided in Table 3.
Table 3. Major Capital Projects Costs and Funding Needs
Major Capital Projects Cost/Funding Estimate (x $1000)
Estimated Total Cost $2,872,600
Estimated Current Funding $500,600
Current Shortfall $2,372,000
Potential Future Funding $800,000
Remaining Shortfall $1,572,000
Pavement Maintenance Needs: MTC estimates deferred pavement maintenance on the local
street system in the Contra Costa County jurisdictions to exceed $1.1 billion in year 2027, down
from $1.7 billion if SB1 revenues were not in place. Attachment B provides details by
jurisdiction on projected pavement condition and deferred maintenance in 2027 based on
MTC’s StreetSaver Pavement Management Program used by all jurisdictions in Contra Costa
County. Table 4 provides a summary of Contra Costa County Pavement Needs.
1.3-606-10-19 TWIC Meeting Agenda
Packet Pg.150 of 192
Contra Costa Transportation Authority STAFF REPORT
June 5, 2019
Page 7 of 8
Table 4. Pavement Condition and Maintenance Backlog in Contra Costa County
2017 Pavement
Condition Index (PCI)
2027 PCI with SB1 Funds 2027 PCI without SB1 Funds
71 70 61
2017 Maintenance
Backlog
2027 Maintenance
Backlog with SB1 Funding
2027 Maintenance Backlog
without SB1 Funding
$858,559,000 $1,133,180,981 $1,695,696,201
Pedestrian and Bicycle Project Needs: The Countywide Bicycle and Pedestrian Plan (CBPP),
completed in 2018, estimates the cost of pedestrian and bicycle projects included in the
Comprehensive Transportation Project List (CTPL) at $1.4 billion, of which $1.2 billion in funding
is needed. The plan estimates current fund sources could provide about $0.8 billion in the
future, leaving about $0.4 billion unfunded. Table 5 provides a summary from the CBPP.
Table 5. Pedestrian/Bicycle Projects Costs and Funding
Pedestrian/Bicycle Projects Cost/Funding Estimate
(x $1000)
Estimated Total Cost $1,404,069
Estimated Current Funding $172,000
Current Shortfall $1,232,069
Potential Future Funding $790,000
Remaining Shortfall $442,069
Transit Needs: With the desire to provide more frequent, secure and reliable transit service for
commuters, students, seniors and people with disabilities, additional funding will be needed to
enhance these services beyond what is available now. In addition, as transit agencies are
required to switch their fleets to zero emission buses, more funding will be required. Currently,
staff does not have an estimate of unmet transit needs.
A summary of identified unmet needs is shown below, taking into consideration SB1 and RM3
funding:
1.3-706-10-19 TWIC Meeting Agenda
Packet Pg.151 of 192
Contra Costa Transportation Authority STAFF REPORT
June 5, 2019
Page 8 of 8
Major Capital Projects $1.6+ billion
Pavement Maintenance $1.1 billion
Pedestrian and Bicycle Network $0.4 billion
Transit Service TBD
TOTAL UNMET TRANSPORTATION NEEDS: $3.1+ billion
A new local fund source will help address some of those needs, and also ensure that Contra
Costa County is well positioned to take advantage of State and federal funds that require a
match to receive funding. It will also help prepare Contra Costa County’s transportation system
for future challenges as technology continues to impact the Bay Area transportation system.
1.3-806-10-19 TWIC Meeting Agenda
Packet Pg.152 of 192
dd,D Ed1.3-906-10-19 TWIC Meeting Agenda
Packet Pg.153 of 192
dd,D Ed1.3-1106-10-19 TWIC Meeting Agenda
Packet Pg.154 of 192
Contra Costa Transportation Authority STAFF REPORT
Meeting Date: June 5, 2019
Subject Approval of the Transportation Expenditure Plan (TEP) Sales Tax
Revenue Estimate and Regional Transportation Planning Committees
(RTPCs) Funding Targets
Summary of Issues Section 180200 et seq. of the California Public Utilities Code states that
a transportation sales tax shall 1) provide the tax rate; 2) specify the
period during which the tax shall be imposed; and 3) specify the
purposes for which the revenue derived from the tax will be used.
Recommendations Staff seeks direction on the tax rate and duration of a new sales tax,
which if approved by the voters, would take effect on July 1, 2020.
Financial Implications A new half-cent sales tax would generate approximately $3.06 billion in
current dollars over a 30-year period.
Options N/A
Attachments A.Summary of Revenue estimates from a new half-cent sales tax
starting in July 1, 2020 (March 2020 Ballot) under various scenarios
B.Revenue Estimates developed by HdL Companies
Changes from
Committee
N/A
Background
At its meeting of May 15, 2019, the Authority Board directed staff to undertake tasks to
develop a TEP for possible consideration on a ballot as early as March 2020. The TEP work plan
calls for the Authority to release an initial draft of the TEP at the June 19 Authority Board
meeting. The Authority plans to seek input from all affected stakeholders, including the RTPCs,
Authority standing advisory committees, and the public on the Initial Draft TEP prior to
adopting a final version at it August 21, 2019 meeting. An important element of developing a
TEP is the estimate of funding that a new sales tax would generate.
1.4-106-10-19 TWIC Meeting Agenda
Packet Pg.155 of 192
Contra Costa Transportation Authority STAFF REPORT
June 5, 2019
Page 2 of 3
New Measure Time Frame and Revenue Estimates
Staff seeks direction on the terms of a new sales tax measure. The new Measure would start on
July 1, 2020 if passed in March 2020. Attachment A provides the revenue estimates for 14 years
(to coincide with expiration of Measure J), as well as 20, 25, 30, 35 and 40-year ½ cent sales tax
measures along with their expiration dates, assuming a start date of July 1, 2020. For a start
date of July 1, 2020 (March 2020 ballot), a new ½ cent 30-year Measure is estimated to
generate $3.06 billion.
The Authority retained HdL Companies (HdL) to develop the revenue estimates (Attachment B).
The revenue estimate uses the same financial assumptions proposed for the development of
the 2019 Measure J Strategic Plan through 2034. These assumptions included a near term
flattening of revenue growth (possible modest recession) with a recovery thereafter. For the
remaining longer portion of the estimate (years 2034 through 2060), HdL used a slower growth
assumption as increases in population will likely soften compared to Contra Costa County’s
most recent history when more areas are fully developed, and future economic conditions will
likely include additional uncertainties and recessionary periods that make using a more
conservative approach prudent.
For a 30-year measure, the forecast for the average nominal growth rate is still a healthy 3.1%.
However, this rate is lower than actual rate experienced in the last 28 years (1990 – 2018) of
3.48%.
Under Measure J, each subregion share of projected revenues was based on its population at
the midpoint of the measure. Staff recommends applying the same methodology to establish
subregional equity for the proposed new measure. Based on the Association of Bay Area
Governments (ABAGs’) Projection 2013, each subregion population was estimated at 5-year
intervals starting in 2015. For a new 30-year measure, year 2035 represents the midpoint of a
new measure.
Population estimates for each subregion under different horizon years are shown in Table 1,
while Table 2 shows each subregion share of revenues from a new 30-year ½ cent measure.
1.4-206-10-19 TWIC Meeting Agenda
Packet Pg.156 of 192
Contra Costa Transportation Authority STAFF REPORT
June 5, 2019
Page 3 of 3
Table 1: Population Estimates by Subregion*
Population 2015 2020 2025 2030 2035
TRANSPLAN** 305,125 318,025 331,425 345,875 361,275
TRANSPAC** 314,225 322,525 340,925 359,575 379,675
WCCTAC** 249,625 260,725 272,225 284,775 298,075
SWAT** 216,725 222,225 228,025 234,175 241,275
TOTAL 1,085,700 1,123,500 1,172,600 1,224,400 1,280,300
* Based on ABAG Projection 2013.
**East County Transportation Planning (TRANSPLAN) Committee, Transportation Partnership and Cooperation
(TRANSPAC), West Contra Costa Transportation Advisory Committee (WCCTAC), and Southwest Area
Transportation Committee (SWAT)
Table 2: Revenue Targets By Subregion – July 1, 2020 Start Date
Subregion
2035 Percentages
POPULATION
30-year New Sales Tax Measure
REVENUE ESTIMATE
( x 1,000 in constant 2018
dollars)
TRANSPLAN 28.22% $ 863,671
TRANSPAC 29.66% $ 907,658
WCCTAC 23.28% $ 712,584
SWAT 18.85% $ 576,796
TOTAL* 100.00% $ 3,060,709
* may not add up due to rounding
Staff seeks direction on the tax rate and duration of a new sales tax, which if approved by the
voters, would take effect on July 1, 2020.
1.4-306-10-19 TWIC Meeting Agenda
Packet Pg.157 of 192
dd,D Ed1.4-506-10-19 TWIC Meeting Agenda
Packet Pg.158 of 192
Contra Costa Transportation Authority - New 0.5% MeasureEXTENDED SALES AND USE TAX BUDGET ESTIMATE12345Industry GroupAutos And Transportation 18,900,585 2.0% 19,140,012 1.3% 18,124,112 -5.3% 18,396,012 1.5% 19,131,852 4.0% 20,279,764 6.0% 21,496,549 6.0% 22,786,342 6.0% 24,153,523 6.0%Building And Construction 9,734,834 8.8% 10,124,860 4.0% 9,799,460 -3.2% 9,946,460 1.5% 10,344,318 4.0% 10,964,978 6.0% 11,622,876 6.0% 12,320,249 6.0% 13,059,464 6.0%Business And Industry 15,391,985 3.4% 16,231,348 5.5% 15,921,248 -1.9% 16,160,048 1.5% 16,564,049 2.5% 17,143,791 3.5% 17,743,824 3.5% 18,364,857 3.5% 19,007,627 3.5%Food And Drugs5,581,703 1.7% 5,697,990 2.1% 5,578,990 -2.1% 5,673,790 1.7% 5,787,266 2.0% 5,931,947 2.5% 6,080,246 2.5% 6,232,252 2.5% 6,388,0592.5%Fuel And Service Stations8,069,347 11.4% 9,915,837 22.9% 8,584,737 -13.4% 8,670,537 1.0% 8,930,653 3.0% 9,377,186 5.0% 9,846,045 5.0% 10,338,347 5.0% 10,855,265 5.0%General Consumer Goods 23,882,239 0.7% 24,822,529 3.9% 24,134,129 -2.8% 24,375,429 1.0% 24,984,815 2.5% 25,734,359 3.0% 26,506,390 3.0% 27,301,582 3.0% 28,120,629 3.0%Restaurants And Hotels10,146,415 3.4% 10,441,376 2.9% 10,455,476 0.1% 10,769,176 3.0% 11,307,635 5.0% 11,986,093 6.0% 12,705,258 6.0% 13,467,574 6.0% 14,275,628 6.0%Transfers & Unidentified102,635 0.2% 182,379 77.7% 182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0%Subtotal Point of Sale91,809,743 3.5% 96,556,331 5.2% 92,780,531 -3.9% 94,173,831 1.5% 97,232,968 3.2% 101,600,496 4.5% 106,183,568 4.5% 110,993,583 4.5% 116,042,574 4.5%Administration Cost(947,112) -6.2% (955,490) 0.9% (1,020,586) 6.8% (1,035,912) 1.5% (1,069,563) 3.2% (1,117,605) 4.5% (1,168,019)(1,220,929)(1,276,468)Total90,862,631 3.6% 95,600,841 5.2% 91,759,945 -4.0% 93,137,919 1.5% 96,163,405 3.2% 100,482,891 4.5% 105,015,549 4.5% 109,772,653 4.5% 114,766,105 4.5%ProjectedProjectedActualProjectedProjectedProjectedProjectedProjectedFY 2017-18FY 2018-19FY 2019-20FY 2020-21FY 2021-22FY 2022-23ProjectedFY 2023-24FY 2024-25FY 2025-26BY - 5/28/2019 10:21 AMPage 1 of 5dd,D Ed1.4-706-10-19 TWIC Meeting Agenda
Packet Pg.159 of 192
Industry GroupAutos And TransportationBuilding And ConstructionBusiness And IndustryFood And DrugsFuel And Service StationsGeneral Consumer GoodsRestaurants And HotelsTransfers & UnidentifiedSubtotal Point of SaleAdministration CostTotal06 7 8 9 10 11 12 13 1425,602,734 6.0% 27,138,898 6.0% 28,767,232 6.0% 30,493,266 6.0% 32,322,862 6.0% 34,262,234 6.0% 36,317,968 6.0% 38,497,046 6.0% 39,459,472 2.5%13,843,031 6.0% 14,673,613 6.0% 15,554,030 6.0% 16,487,272 6.0% 17,476,508 6.0% 18,525,099 6.0% 19,636,605 6.0% 20,814,801 6.0% 21,439,245 3.0%19,672,894 3.5% 20,361,446 3.5% 21,074,096 3.5% 21,811,690 3.5% 22,575,099 3.5% 23,365,227 3.5% 24,183,010 3.5% 25,029,416 3.5% 25,530,004 2.0%6,547,760 2.5% 6,711,454 2.5% 6,879,240 2.5% 7,051,221 2.5% 7,227,502 2.5% 7,408,190 2.5% 7,593,394 2.5% 7,783,229 2.5% 7,938,894 2.0%11,398,028 5.0% 11,967,929 5.0% 12,566,326 5.0% 13,194,642 5.0% 13,854,374 5.0% 14,547,093 5.0% 15,274,448 5.0% 16,038,170 5.0% 16,198,552 1.0%28,964,248 3.0% 29,833,175 3.0% 30,728,171 3.0% 31,650,016 3.0% 32,599,516 3.0% 33,577,502 3.0% 34,584,827 3.0% 35,622,372 3.0% 36,156,707 1.5%15,132,166 6.0% 16,040,096 6.0% 17,002,502 6.0% 18,022,652 6.0% 19,104,011 6.0% 20,250,252 6.0% 21,465,267 6.0% 22,753,183 6.0% 23,322,012 2.5%182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0%121,343,241 4.6% 126,908,991 4.6% 132,753,976 4.6% 138,893,138 4.6% 145,342,252 4.6% 152,117,975 4.7% 159,237,897 4.7% 166,720,595 4.7% 170,227,265 2.1%(1,334,776)(1,395,999)(1,460,294)(1,527,825)(1,598,765)(1,673,298)(1,751,617)(1,833,927)(1,872,500)120,008,466 4.6% 125,512,992 4.6% 131,293,683 4.6% 137,365,314 4.6% 143,743,487 4.6% 150,444,677 4.7% 157,486,280 4.7% 164,886,669 4.7% 168,354,765 2.1%ProjectedProjectedProjectedProjectedProjectedProjectedProjectedProjectedProjectedFY 2029-30FY 2030-31FY 2031-32FY 2032-33FY 2033-34FY 2034-35FY 2026-27FY 2027-28FY 2028-29BY - 5/28/2019 10:21 AMPage 2 of 51.4-806-10-19 TWIC Meeting Agenda
Packet Pg.160 of 192
Industry GroupAutos And TransportationBuilding And ConstructionBusiness And IndustryFood And DrugsFuel And Service StationsGeneral Consumer GoodsRestaurants And HotelsTransfers & UnidentifiedSubtotal Point of SaleAdministration CostTotal15161718192021222340,445,959 2.5% 41,457,108 2.5% 42,493,536 2.5% 43,555,874 2.5% 44,644,771 2.5% 45,760,890 2.5% 46,904,912 2.5% 48,077,535 2.5% 49,279,474 2.5%22,082,422 3.0% 22,744,895 3.0% 23,427,242 3.0% 24,130,059 3.0% 24,853,961 3.0% 25,599,580 3.0% 26,367,567 3.0% 27,158,594 3.0% 27,973,352 3.0%26,040,604 2.0% 26,561,416 2.0% 27,092,644 2.0% 27,634,497 2.0% 28,187,187 2.0% 28,750,931 2.0% 29,325,950 2.0% 29,912,469 2.0% 30,510,718 2.0%8,097,672 2.0% 8,259,625 2.0% 8,424,817 2.0% 8,593,314 2.0% 8,765,180 2.0% 8,940,484 2.0% 9,119,293 2.0% 9,301,679 2.0% 9,487,713 2.0%16,360,537 1.0% 16,524,142 1.0% 16,689,384 1.0% 16,856,278 1.0% 17,024,841 1.0% 17,195,089 1.0% 17,367,040 1.0% 17,540,710 1.0% 17,716,117 1.0%36,699,058 1.5% 37,249,544 1.5% 37,808,287 1.5% 38,375,411 1.5% 38,951,042 1.5% 39,535,308 1.5% 40,128,338 1.5% 40,730,263 1.5% 41,341,217 1.5%23,905,063 2.5% 24,502,689 2.5% 25,115,257 2.5% 25,743,138 2.5% 26,386,716 2.5% 27,046,384 2.5% 27,722,544 2.5% 28,415,608 2.5% 29,125,998 2.5%182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0%173,813,694 2.1% 177,481,798 2.1% 181,233,546 2.1% 185,070,950 2.1% 188,996,077 2.1% 193,011,045 2.1% 197,118,023 2.1% 201,319,237 2.1% 205,616,967 2.1%(1,911,951)(1,952,300)(1,993,569)(2,035,780)(2,078,957)(2,123,121)(2,168,298)(2,214,512)(2,261,787)171,901,743 2.1% 175,529,499 2.1% 179,239,977 2.1% 183,035,170 2.1% 186,917,120 2.1% 190,887,923 2.1% 194,949,725 2.1% 199,104,725 2.1% 203,355,180 2.1%ProjectedProjectedProjectedProjectedProjectedProjectedProjectedProjectedProjectedFY 2041-42FY 2042-43FY 2043-44FY 2035-36FY 2036-37FY 2037-38FY 2038-39FY 2039-40FY 2040-41BY - 5/28/2019 10:21 AMPage 3 of 51.4-906-10-19 TWIC Meeting Agenda
Packet Pg.161 of 192
Industry GroupAutos And TransportationBuilding And ConstructionBusiness And IndustryFood And DrugsFuel And Service StationsGeneral Consumer GoodsRestaurants And HotelsTransfers & UnidentifiedSubtotal Point of SaleAdministration CostTotal24252627282930313250,511,461 2.5% 51,774,247 2.5% 53,068,603 2.5% 54,395,318 2.5% 55,755,201 2.5% 57,149,081 2.5% 58,577,808 2.5% 60,042,253 2.5% 61,543,310 2.5%28,812,553 3.0% 29,676,929 3.0% 30,567,237 3.0% 31,484,254 3.0% 32,428,782 3.0% 33,401,645 3.0% 34,403,695 3.0% 35,435,805 3.0% 36,498,880 3.0%31,120,932 2.0% 31,743,351 2.0% 32,378,218 2.0% 33,025,782 2.0% 33,686,298 2.0% 34,360,024 2.0% 35,047,224 2.0% 35,748,169 2.0% 36,463,132 2.0%9,677,467 2.0% 9,871,016 2.0% 10,068,437 2.0% 10,269,806 2.0% 10,475,202 2.0% 10,684,706 2.0% 10,898,400 2.0% 11,116,368 2.0% 11,338,695 2.0%17,893,278 1.0% 18,072,211 1.0% 18,252,933 1.0% 18,435,463 1.0% 18,619,817 1.0% 18,806,016 1.0% 18,994,076 1.0% 19,184,016 1.0% 19,375,857 1.0%41,961,335 1.5% 42,590,755 1.5% 43,229,616 1.5% 43,878,060 1.5% 44,536,231 1.5% 45,204,275 1.5% 45,882,339 1.5% 46,570,574 1.5% 47,269,133 1.5%29,854,148 2.5% 30,600,501 2.5% 31,365,514 2.5% 32,149,652 2.5% 32,953,393 2.5% 33,777,228 2.5% 34,621,659 2.5% 35,487,200 2.5% 36,374,380 2.5%182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0%210,013,552 2.1% 214,511,390 2.1% 219,112,937 2.1% 223,820,714 2.1% 228,637,303 2.2% 233,565,353 2.2% 238,607,579 2.2% 243,766,765 2.2% 249,045,765 2.2%(2,310,149)(2,359,625)(2,410,242)(2,462,028)(2,515,010)(2,569,219)(2,624,683)(2,681,434)(2,739,503)207,703,403 2.1% 212,151,765 2.1% 216,702,695 2.1% 221,358,686 2.1% 226,122,293 2.2% 230,996,134 2.2% 235,982,896 2.2% 241,085,330 2.2% 246,306,261 2.2%ProjectedProjectedProjectedProjectedProjectedProjectedProjectedFY 2047-48FY 2044-45FY 2045-46FY 2046-47ProjectedFY 2051-52ProjectedFY 2052-53FY 2048-49FY 2049-50FY 2050-51BY - 5/28/2019 10:21 AMPage 4 of 51.4-1006-10-19 TWIC Meeting Agenda
Packet Pg.162 of 192
Industry GroupAutos And TransportationBuilding And ConstructionBusiness And IndustryFood And DrugsFuel And Service StationsGeneral Consumer GoodsRestaurants And HotelsTransfers & UnidentifiedSubtotal Point of SaleAdministration CostTotal3334353637383963,081,893 2.5% 64,658,940 2.5% 66,275,413 2.5% 67,932,299 2.5% 69,630,606 2.5% 71,371,371 2.5% 73,155,656 2.5%37,593,846 3.0% 38,721,661 3.0% 39,883,311 3.0% 41,079,810 3.0% 42,312,205 3.0% 43,581,571 3.0% 44,889,018 3.0%37,192,395 2.0% 37,936,243 2.0% 38,694,968 2.0% 39,468,867 2.0% 40,258,244 2.0% 41,063,409 2.0% 41,884,677 2.0%11,565,469 2.0% 11,796,778 2.0% 12,032,714 2.0% 12,273,368 2.0% 12,518,836 2.0% 12,769,212 2.0% 13,024,597 2.0%19,569,615 1.0% 19,765,311 1.0% 19,962,964 1.0% 20,162,594 1.0% 20,364,220 1.0% 20,567,862 1.0% 20,773,541 1.0%47,978,170 1.5% 48,697,842 1.5% 49,428,310 1.5% 50,169,734 1.5% 50,922,280 1.5% 51,686,115 1.5% 52,461,406 1.5%37,283,739 2.5% 38,215,833 2.5% 39,171,229 2.5% 40,150,510 2.5% 41,154,272 2.5% 42,183,129 2.5% 43,237,707 2.5%182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0% 182,379 0.0%254,447,506 2.2% 259,974,988 2.2% 265,631,288 2.2% 271,419,561 2.2% 277,343,043 2.2% 283,405,049 2.2% 289,608,981 2.2%(2,798,923)(2,859,725)(2,921,944)(2,985,615)(3,050,773)(3,117,456)(3,185,699)251,648,583 2.2% 257,115,263 2.2% 262,709,344 2.2% 268,433,946 2.2% 274,292,269 2.2% 280,287,593 2.2% 286,423,282 2.2%ProjectedFY 2053-54ProjectedFY 2057-58ProjectedFY 2058-59ProjectedFY 2059-60ProjectedFY 2054-55ProjectedFY 2055-56ProjectedFY 2056-57BY - 5/28/2019 10:21 AMPage 5 of 51.4-1106-10-19 TWIC Meeting Agenda
Packet Pg.163 of 192
Contra Costa Transportation Authority STAFF REPORT
Meeting Date: June 5, 2019
Subject Proposed Transportation Expenditure Plan (TEP) Structure and
Strategies
Summary of Issues At its meeting on May 15, 2019, the Authority Board approved the
guiding principles and work plan for development of a new proposed
TEP and directed staff to undertake activities towards development of a
proposed TEP that could be placed on the March 3, 2020 ballot. Staff
will discuss proposed structure and strategies to develop a proposed
Initial Draft TEP (target date of June 19, 2019).
Recommendations Staff will discuss and seek input from the Authority Board on proposed
structure and strategies to develop a proposed Initial Draft TEP.
Financial Implications None
Options The Authority Board could direct staff to not continue with the
development of a proposed Initial Draft TEP.
Attachments None
Changes from
Committee
N/A
Background
At its meeting on May 15, 2019, the Authority Board approved the guiding principles and work
plan for development of a new proposed TEP and directed staff to undertake activities towards
the development of a proposed TEP that could be placed on the March 3, 2020 ballot. Staff has
conducted public opinion polls and focus groups, received preliminary feedback from Regional
Transportation Planning Committees (RTPCs) and has had initial discussions regarding placing a
sales tax measure on the ballot with various stakeholders. Using this information, staff will
discuss and seek input from the Authority Board on a proposed structure and strategies to
develop a proposed Initial Draft TEP (target date of June 19, 2019).
1.5-106-10-19 TWIC Meeting Agenda
Packet Pg.164 of 192
Contra Costa Transportation Authority STAFF REPORT
Meeting Date: June 5, 2019
Subject Discuss Initial Draft Transportation Expenditure Plan (TEP)
Summary of Issues At its meeting on May 15, 2019, the Authority Board approved the
guiding principles and work plan for development of a new proposed
TEP and directed staff to undertake activities towards development of a
proposed TEP that could be placed on the March 3, 2020 ballot. Staff
has conducted public opinion polls and focus groups, reviewed current
transportation needs and funding outlook, received preliminary
feedback from Regional Transportation Planning Committees (RTPCs)
and has had initial discussions regarding placing a sales tax measure on
the ballot with various stakeholders. Staff has also reviewed the 2016
TEP regarding its funding amounts and policy statements, and has
reviewed other countywide transportation sales tax measures that have
been passed by voters in recent years. Using this information, staff has
developed an initial draft of project/program funding categories and
possible funding amounts as a framework for soliciting input towards
development of a proposed Initial Draft TEP (target date of June 19,
2019) and a proposed final TEP (target date of August 21, 2019). Staff
will outline the major policies contained in the 2016 TEP and seek input
on any potential changes to be considered for a proposed Initial Draft
TEP.
Recommendations Staff seeks Authority Board comments regarding the framework,
funding categories and policy statements included in the proposed
Initial Draft TEP.
Financial Implications The expected revenue from a new transportation sales tax depends on
the amount and term. As an example, a new half-cent sales tax would
generate approximately $3.06 billion in current dollars over a 30-year
period.
Options The Authority Board could elect to direct staff to develop the Initial
Draft TEP using an alternative process.
1.6-106-10-19 TWIC Meeting Agenda
Packet Pg.165 of 192
Contra Costa Transportation Authority STAFF REPORT
June 5, 2019
Page 2 of 3
Attachments A.Proposed Initial Draft TEP, Possible Funding Categories and Amounts
B.2016 TEP Policy Statements
Changes from
Committee
N/A
Background
At its meeting on May 15, 2019, staff provided a summary of the results of the public opinion
poll, and the Authority Board approved the guiding principles and work plan for development of
a proposed new TEP and directed staff to undertake activities towards development of a TEP
that could be placed on the March 3, 2020 ballot. Staff has reviewed the results of the public
opinion polls and focus groups, assessed current transportation needs and funding outlook,
received initial feedback from RTPCs and has conducted initial discussions regarding placing a
sales tax measure on the ballot with various stakeholders. Staff has also reviewed the 2016 TEP
regarding its funding amounts and policy statements, and has reviewed other countywide
transportation sales tax measures that have been passed by voters in recent years. Using this
information, staff has developed a proposed Initial Draft TEP as a framework for soliciting input
towards development of a proposed Initial Draft TEP (target date of June 19, 2019) and a
proposed final TEP (target date of August 21, 2019).
Attachment A, Proposed Initial Draft TEP, Possible Funding Cate gories and Amounts, provides
an initial distribution of expected sales tax measure revenues across recommended funding
categories. Revenues are based on a half-cent sales tax for a 30 year period (July 2020 through
June 2050). This overall revenue amount may need to be adjusted using the Authority Board’s
direction from an earlier meeting agenda item. The funding categories and amounts in this
proposed initial draft may need to be revised based on the prior agenda discussion on the TEP
Strategies. Funding Categories, sample projects and programs, will be discussed with the
Authority Board and refined to reflect sub-regional equity, as well as any proposed eligibility
criteria. The proposed Initial Draft TEP to be discussed at the Authority Board meeting provides
the following distribution among the Bay Area Rapid Transit District (BART) and access
improvements, bike and pedestrian improvements, local street improvements, transit
improvements and alternative modes, and freeway improvements.
1.6-206-10-19 TWIC Meeting Agenda
Packet Pg.166 of 192
Contra Costa Transportation Authority STAFF REPORT
June 5, 2019
Page 3 of 3
BART Bike/Pedestrian Local Transit and
Alternative
Modes
Freeway
7.4% 10.ϭ% 26.ϯ% 30.6% 21.7%
Staff will provide an overview and framework of the policy statements that were included in
the 2016 TEP and discuss any potential changes to the policy statements that may be included
in the a proposed new Initial Draft TEP. Attachment B contains the following policy statements
that were included in the 2016 TEP:
x Growth Management Program (GMP)
x Urban Limit Line (ULL) Compliance Requirements
x Complete Streets Policy
x Advanced Mitigation Program
x Taxpayers Safeguards and Accountability
Staff will discuss factors to be considered for potential changes to the policy statements, such
as effects of statutes and regulations (such as Senate Bills 375 [SB375] and SB743), the County’s
recent ULL review, progress towards establishing and funding an Advance Mitigation Program,
the review of other successful transportation sales tax measures and input from various
stakeholders. Staff is proposing a new Transit Policy to be considered by the Authority Board
based on discussions that have occurred among transit providers and the public’s perspective
on improving connectivity among transit providers and future transit solutions.
Staff will provide additional information and context of the funding categories and amounts and
seek direction on proposed policy statements that may be included in the proposed Initial Draft
TEP for consideration at future Authority Board meetings leading up to the proposed Initial
Draft TEP on June 19, 2019.
1.6-306-10-19 TWIC Meeting Agenda
Packet Pg.167 of 192
$millions %Central(a)Southwest(b)West(c)East(d)EligibilityCompetitiveProjectSelectionProcess2016TEPRelieve Traffic on Highways and InterchangesImprove Transit reliability along I-80 and I-680 Corridors145.00 4.74% 25.00 25.00 95.0055.00I-80 Transit LaneI-80 Shared Mobility HubsTransit Connection between Richmond Ferry, BART, and Contra Costa CollegeSan Pablo Avenue Multimodal ImprovementsI-80 Express Bus Service ImprovementsI-680 Transit Improvements and Shared Mobility HubsI-680 Part-time Transit LaneIncentives for alternative modesRelieve Congestion and Improve Local Access along Interstate 80 Corridor60.00 1.96%60.0060.00Innovate 80 (Enhance Smart Corridor and HOV Lane, HOV enforcement)I-80/San Pablo Dam RoadI-80/Pinole Valley RoadIncentives for alternative modesImprove Traffic Flow and Local Access to Richmond-San Rafael Bridge20.000.65%20.00Extend HOV Lane on I-580Richmond Parkway Interchange ImprovementsIncentives for alternative modesConnector from I-580 to Point MolateImprove Traffic Flow and Interchanges along Highway 4 and State Route 242200.00 6.53% 154.2045.80108.00Operational Improvements along Highway 4 from 242 to Bailey Road (SR4 OIP)I-680/Highway 4 Interchange (Future Phases)60.00SR-242/Clayton RoadSR-4 ICM and Improve HOV LanesIncentives for alternative modesImprove Local Access to Highway 4 and Byron Airport150.00 4.90%150.00 No new alignments and access restrictions outside ULL117.00Vasco-Byron Road ConnectorVasco Road WideningInterchanges at Balfour, Marsh Creek, Walnut, Camino DiabloByron Airport EnhancementsRelieve Congestion and Improve Local Access along Interstate 680 Corridor200.00 6.53% 105.00 95.00230.00I-680 NB Express LanesI-680 Advanced TechnologiesI-680/Concord AvenueIncentives for alternative modesImprove Traffic Flow on State Route 24 and Modernize the Old Bores of Caldecott Tunnel35.00 1.14%35.0020.00SR-24/Camino PabloModernization and Safety Improvements of Old Bores of Caldecott TunnelMake Bus, Ferry, Commuter Rail and BART Safer, Cleaner, and more ReliableIncrease Bus Services and Reliability in West Contra Costa110.55 3.61%110.55Conform to New Expenditure Plan Policy for Transit110.55Provide Convenient and Reliable Transit Services in Central, East and Southwest Contra Costa230.00 7.51% 90.00 78.0062.00 Conform to New Expenditure Plan Policy for Transit184.40East County Transit Extension to Brentwood and Connectivity to Transit, Rail, and Parking100.00 3.27%100.0070.00Transit ExtensionBrentwood Intermodal StationShuttle Service and Shared Mobility HubsEnhance Ferry Service and Commuter Rail in Contra Costa80.00 2.61% 30.0030.00 20.00 Conform to New Expenditure Plan Policy for Transit50.00Hercules Ferry ServicesMartinez to Antioch Ferry ServicesHercules Regional Intermodal StationConnect Oakley San Joaquin Station to Antioch e-BARTSan Joaquin Rail Station and Park/Ride Lot in OakleyTransit Connection from Martinez Amtrak to Concord BARTFunding Category(Improvements listed are examples and types of projects that may be funded)Distribution of Funding by Subregiondd,D Ed1.6-506-10-19 TWIC Meeting Agenda
Packet Pg.168 of 192
$millions %Central(a)Southwest(b)West(c)East(d)EligibilityCompetitiveProjectSelectionProcess2016TEPFunding Category(Improvements listed are examples and types of projects that may be funded)Distribution of Funding by SubregionCleaner, Safer BART100.00 3.27% 30.00 19.00 23.00 28.00 MOE, Systemwide Match Program, No NewBART CarsStation ModernizationAdditional Trains cars for e-BART, Parking and Access Improvements to BART100.00 3.27% 30.00 19.00 23.00 28.00 MOE, Conform to New Exp. Plan Policy for Transit300.00e-BART carsParking and Access improvementsProviding Affordable and Safe Transportation for Children, Seniors, Veterans, and People with DisabilitiesSafe Transportation for Youth and Students100.00 3.27% 13.60 31.40 40.00 15.0063.96Affordable Transportation for Seniors, Veterans, and People with Disabilities150.00 4.90% 40.00 25.00 37.00 48.00115.01Local Improvements to Make Your Community Better and Protect the EnvironmentFix and Modernize Local Roads465.23 15.20% 131.31 103.70 101.03 129.19Growth Management Plan, MOE683.50CompleteandImproveTrafficFlowonLocalStreets290.00 9.47% 108.27 41.90 48.65 91.18 15% on Ped/bike Improv., Complete Street Policyx 290.00Widen Ygnacio Valley Road in ConcordSand Creek Rd in Brentwood and AntiochViera Avenue in AntiochSan Pablo BNSF in RichmondCutting Blvd at UPRR in RichmondHarbor Way at BNSF in RichmondWillow Pass Road Widening in ConcordAlhambra Avenue Improvements in Martinez and Contra Costa CountyKirker Pass Road Truck Climbing Lane in Contra Costa County near PittsburgSaint Mary/Bollinger Canyon Road Intersection Improvements and Roundabout in MoragaCamino Tassajara Road Widening in Contra Costa CountyCrow Canyon Road Widening in San RamonWidening O'Hara Avenue in OakleyDeer Valley Road in AntiochWestLelandRoadExtensioninPittsburgBrentwood Blvd in BrentwoodLone Tree Way in Brentwood…and OthersImprove Walking and Biking on Streets and Trails153.87 5.03% 38.84 39.25 35.18 40.60$38m to EBRPD for Trailsx 115.00I-80/Central Avenue (Phase 3)23rd Street POCBollingerCanyonRoadPOCforIronHorseTrailConnect Iron Horse Trail and Contra Costa Trail…and OthersFocused Growth, Support Economic Development and Create Jobs in Contra Costa80.00 2.61% 20.21 13.16 16.00 30.63x 100.00Advance Mitigation ProgramConform to Expenditure Plan Advance Mitigation Policy…and OthersSeamless Connected Transportation Options and Reduce Emissions150.00 4.90% 51.00 25.40 38.60 35.00x 65.00Zero Emission Vehicle Program for Contra CostaSmart rideshare, carshare, and bikeshare servicesOn-demand and guaranteed transit servicesSmart payment systemsData sharing to improve mobility choices…and OthersRegional Transportation Priorities18.63 0.61% 5.00 3.63 5.00 5.0018.70Transportation Planning, Facilities & Services91.82 3.00% 27.23 17.30 21.38 25.9143.05Administration30.61 1.00% 8.00 5.06 8.19 9.3614.35TOTAL3060.71 100.0% 907.66 576.80 712.58 863.672873.52ULL: Urban Limit LinePopulation Based Share3060.71907.66 576.80 712.58 863.67MOE: Maintenance of EffortPopulation Share (2035 Estimate) of Total29.66% 18.85% 23.28% 28.22%EBRPD: East Bay Regional Park District1.6-606-10-19 TWIC Meeting Agenda
Packet Pg.169 of 192
32/,&<67$7(0(176
7+(*52:7+0$1$*(0(17352*5$0
Goals and Objectives
7KHRYHUDOOJRDORIWKH*URZWK0DQDJHPHQW3URJUDPLVWRSUHVHUYHDQGHQKDQFHWKHTXDOLW\RIOLIHDQGSURPRWHDhealthy,
strong economy to benefit the people and areas of Contra Costa through a cooperative, multi-jurisdictional SURFHVVIRU
PDQDJLQJJURZWKZKLOHPDLQWDLQLQJORFDODXWKRULW\RYHUODQGXVHGHFLVLRQV
7KHREMHFWLYHVRIWKH*URZWK0DQDJHPHQW3URJUDPDUHWR
x $VVXUHWKDWQHZUHVLGHQWLDOEXVLQHVVDQGFRPPHUFLDOJURZWKSD\VIRUWKHIDFLOLWLHVUHTXLUHGWRPHHWWKHGHPDQGVUHVXOWLQJ
IURPWKDWJURZWK
x 5HTXLUHFRRSHUDWLYHWUDQVSRUWDWLRQDQGODQGXVHSODQQLQJDPRQJ&RQWUD&RVWD&RXQW\FLWLHVWRZQVDQGWUDQVSRUWDWLRQ
DJHQFLHV
x Support land use patterns within Contra Costa that make more efficient use of the transportation system,
consistent ZLWKWKH*HQHUDO3ODQVRIORFDOMXULVGLFWLRQV
x Support infill and redevelopment in existing urban and brownfield areas.
7KH0HDVXUH-7UDQVSRUWDWLRQ([SHQGLWXUH3ODQ*URZWK0DQDJHPHQW3URJUDPZKLFKLQFOXGHV3ULQFLSOHVRI$JUHHPHQWIRU
(VWDEOLVKLQJWKH8UEDQ/LPLW/LQHLVUHSODFHGLQLWVHQWLUHW\E\WKLV*URZWK0DQDJHPHQW3URJUDPDQG8UEDQ/LPLWLine (ULL)
Definitions and Compliance Requirements. (see page 41)
&RPSRQHQWV
7R UHFHLYH LWV VKDUH RI WKH 7UDQVIRUPLQJ &RQWUD &RVWD &RXQW\([SHQGLWXUH3ODQIXQGLQJIURP/RFDO6WUHHWV
0DLQWHQDQFHDQG,PSURYHPHQWVIXQGVDQGLWVVKDUHRI&RQWUD&RVWD¶V0HDVXUH-7UDQVSRUWDWLRQ6DOHV7D[([SHQGLWXUH
3ODQ/RFDO6WUHHWV0DLQWHQDQFH ,PSURYHPHQWVIXQGLQJDQGWREHHOLJLEOHIRU&RQWUD&RVWD¶V0HDVXUH-7UDQVSRUWDWLRQ
6DOHV7D[([SHQGLWXUH7UDQVSRUWDWLRQIRU/LYDEOH&RPPXQLWLHVIXQGVDQGWKH7UDQVIRUPLQJ&RQWUD&RVWD&RXQW\
([SHQGLWXUH3ODQIXQGLQJIURP&RPPXQLW\'HYHORSPHQW7UDQVSRUWDWLRQ3URJUDPIXQGVHDFKMXULVGLFWLRQPXVW
1. Adopt a Growth Management Element
(DFKMXULVGLFWLRQPXVWDGRSWRUPDLQWDLQLQSODFHD*URZWK0DQDJHPHQW(OHPHQWDVSDUWRILWV*HQHUDO3ODQWKDWRXWOLQHVWKH
MXULVGLFWLRQ¶VJRDOVDQGSROLFLHVIRUPDQDJLQJJURZWKDQGUHTXLUHPHQWVIRUDFKLHYLQJWKRVHJRDOV7KH*URZWKManagement
Element must show how the jurisdiction will comply with sections 2–8 below. The Authority will refine its PRGHO*URZWK
0DQDJHPHQW(OHPHQWDQGDGPLQLVWUDWLYHSURFHGXUHVLQFRQVXOWDWLRQZLWKWKH5HJLRQDO7UDQVSRUWDWLRQPlanning Committees to
reflect the revised Growth Management Program.
(DFKMXULVGLFWLRQLVHQFRXUDJHGWRLQFRUSRUDWHRWKHUVWDQGDUGVDQGSURFHGXUHVLQWRLWV*URZWK0DQDJHPHQW(OHPHQWWRVXSSRUW
WKHREMHFWLYHVDQGUHTXLUHGFRPSRQHQWVRIWKLV*URZWK0DQDJHPHQW3URJUDP
2. Adopt a Development Mitigation Program
(DFKMXULVGLFWLRQPXVWDGRSWRUPDLQWDLQLQSODFHDGHYHORSPHQWPLWLJDWLRQSURJUDPWRHQVXUHWKDWQHZJURZWKLVSD\LQJLWV
VKDUHRIWKHFRVWVDVVRFLDWHGZLWKWKDWJURZWK7KLVSURJUDPVKDOOFRQVLVWRIERWKDORFDOSURJUDPWRPLWLJDWH
7KH$XWKRULW\ZLOOWRWKHH[WHQWSRVVLEOHDWWHPSWWRKDUPRQL]HWKH*URZWK0DQDJHPHQWDQGWKH6WDWHPDQGDWHG&RQJHVWLRQManagement
Programs. To the extent they conflict, Congestion Management Program Activities shall take precedence over Growth 0DQDJHPHQW
DFWLYLWLHV
FFWDQHW11 &RQWUD&RVWD7UDQVSRUWDWLRQ$XWKRULW\T #&&7$fl FFWDQHW\RXWXEH
dd,D Ed
1.6-706-10-19 TWIC Meeting Agenda
Packet Pg.170 of 192
Growth Management Program
LPSDFWVRQORFDOVWUHHWVDQGRWKHUIDFLOLWLHVDQGDUHJLRQDOSURJUDPWRIXQGUHJLRQDODQGVXEUHJLRQDOWUDQVSRUWDWLRQSURMHFWV
FRQVLVWHQWZLWKWKH&RXQW\ZLGH&RPSUHKHQVLYH7UDQVSRUWDWLRQ3ODQ
7KHMXULVGLFWLRQ¶VORFDOGHYHORSPHQWPLWLJDWLRQSURJUDPVKDOOHQVXUHWKDWUHYHQXHSURYLGHGIURPWKLVPHDVXUHVKDOOQRWEHXVHG
WRUHSODFHSULYDWHGHYHORSHUIXQGLQJWKDWKDVRUZRXOGKDYHEHHQFRPPLWWHGWRDQ\SURMHFW
7KHUHJLRQDOGHYHORSPHQWPLWLJDWLRQSURJUDPVKDOOHVWDEOLVKIHHVH[DFWLRQVDVVHVVPHQWVRURWKHUPLWLJDWLRQPHDVXUHVWRIXQG
UHJLRQDORUVXEUHJLRQDOWUDQVSRUWDWLRQLPSURYHPHQWVQHHGHGWRPLWLJDWHWKHLPSDFWVRISODQQHGRUIRUHFDVWGHYHORSPHQW5HJLRQDO
PLWLJDWLRQSURJUDPVPD\DGMXVWVXFKIHHVH[DFWLRQVDVVHVVPHQWVRURWKHUPLWLJDWLRQPHDVXUHVZKHQGHYHORSPHQWVare within
walking distance of frequent transit service or are part of a mixed-use development of sufficient density and with
QHFHVVDU\IDFLOLWLHVWRVXSSRUWJUHDWHUOHYHOVRIZDONLQJDQGELF\FOLQJ(DFK5HJLRQDO7UDQVSRUWDWLRQ3ODQQLQJ&RPPLWWHHVKDOO
GHYHORSWKHUHJLRQDOGHYHORSPHQWPLWLJDWLRQSURJUDPIRULWVUHJLRQWDNLQJDFFRXQWRISODQQHGDQGIRUHFDVWJURZWKDQGWKH
0XOWLPRGDO7UDQVSRUWDWLRQ6HUYLFH2EMHFWLYHVDQGDFWLRQVWRDFKLHYHWKHPHVWDEOLVKHGLQWKH$FWLRQ3ODQVIRU5RXWHVof Regional
Significance. Regional Transportation Planning Committees may use existing regional mitigation programs, if FRQVLVWHQW
ZLWKWKLVVHFWLRQWRFRPSO\ZLWKWKH*URZWK0DQDJHPHQW3URJUDP
3. Address Housing Options
(DFKMXULVGLFWLRQVKDOOGHPRQVWUDWHUHDVRQDEOHSURJUHVVLQSURYLGLQJKRXVLQJRSSRUWXQLWLHVIRUDOOLQFRPHOHYHOVDVSDUWRIDUHSRUW
RQWKHLPSOHPHQWDWLRQRIWKHDFWLRQVRXWOLQHGLQLWVDGRSWHG+RXVLQJ(OHPHQW7KHUHSRUWZLOOGHPRQVWUDWHSURJUHVVE\
D &RPSDULQJWKHQXPEHURIKRXVLQJXQLWVDSSURYHGFRQVWUXFWHGRURFFXSLHGZLWKLQWKHMXULVGLFWLRQRYHUWKHpreceding
five years with the number of units needed on average each year to meet the housing objectives
HVWDEOLVKHGLQWKHMXULVGLFWLRQ¶V+RXVLQJ(OHPHQW RU
E,OOXVWUDWLQJKRZWKHMXULVGLFWLRQKDVDGHTXDWHO\SODQQHGWRPHHWWKHH[LVWLQJDQGSURMHFWHGKRXVLQJQHHGVWKURXJK
WKHDGRSWLRQRIODQGXVHSODQVDQGUHJXODWRU\V\VWHPVZKLFKSURYLGHRSSRUWXQLWLHVIRUDQGGRQRWXQGXO\
FRQVWUDLQKRXVLQJGHYHORSPHQW RU
F ,OOXVWUDWLQJKRZDMXULVGLFWLRQ¶V*HQHUDO3ODQDQG]RQLQJUHJXODWLRQVIDFLOLWDWHWKHLPSURYHPHQWDQGGHYHORSPHQWof
sufficient housing to meet those objectives.
,QDGGLWLRQHDFKMXULVGLFWLRQVKDOOFRQVLGHUWKHLPSDFWVWKDWLWVODQGXVHDQGGHYHORSPHQWSROLFLHVKDYHRQWKHORFDO
UHJLRQDODQGFRXQW\ZLGHWUDQVSRUWDWLRQV\VWHPLQFOXGLQJWKHOHYHORIWUDQVSRUWDWLRQFDSDFLW\WKDWFDQUHDVRQDEO\EH
SURYLGHGDQGVKDOOLQFRUSRUDWHSROLFLHVDQGVWDQGDUGVLQWRLWVGHYHORSPHQWDSSURYDOSURFHVVWKDWVXSSRUWWUDQVLWELF\FOH
DQGSHGHVWULDQDFFHVVLQQHZGHYHORSPHQWV
4. Participate in an Ongoing Cooperative, Multi-Jurisdictional Planning Process.
(DFKMXULVGLFWLRQVKDOOSDUWLFLSDWHLQDQRQJRLQJSURFHVVZLWKRWKHUMXULVGLFWLRQVDQGDJHQFLHVWKH5HJLRQDO7UDQVSRUWDWLRQ
Planning Committees and the Authority to create a balanced, safe and efficient transportation system and to manage
the LPSDFWVRIJURZWK-XULVGLFWLRQVVKDOOZRUNZLWKWKH5HJLRQDO7UDQVSRUWDWLRQ3ODQQLQJ&RPPLWWHHVWR
a. Identify Routes of Regional Significance, and establish Multimodal Transportation Service Objectives or
other tools adopted by the Authority for measuring performance and quality of service along routes of
significance,FROOHFWLYHO\UHIHUUHGWRDV0XOWLPRGDO7UDQVSRUWDWLRQ6HUYLFH2EMHFWLYHVIRUWKRVHURXWHVDQGDFWLRQVIRU
DFKLHYLQJWKRVHREMHFWLYHV
b.$SSO\WKH$XWKRULW\¶VWUDYHOGHPDQGPRGHODQGWHFKQLFDOSURFHGXUHVWRWKHDQDO\VLVRI*HQHUDO3ODQ$PHQGPHQWV(GPAs)
and developments exceeding specified thresholds for their effect on the regional transportation system,
LQFOXGLQJRQ$FWLRQ3ODQREMHFWLYHV
c.&UHDWHWKHGHYHORSPHQWPLWLJDWLRQSURJUDPVRXWOLQHGLQVHFWLRQDERYH
d.+HOSGHYHORSRWKHUSODQVSURJUDPVDQGVWXGLHVWRDGGUHVVRWKHUWUDQVSRUWDWLRQDQGJURZWKPDQDJHPHQWLVVXHV
FFWDQHW11 &RQWUD&RVWD7UDQVSRUWDWLRQ$XWKRULW\T #&&7$fl FFWDQHW\RXWXEH
1.6-806-10-19 TWIC Meeting Agenda
Packet Pg.171 of 192
Growth Management Program
,QFRQVXOWDWLRQZLWKWKH5HJLRQDO7UDQVSRUWDWLRQ3ODQQLQJ&RPPLWWHHVHDFKMXULVGLFWLRQZLOOXVHWKHWUDYHOGHPDQGPRGHOWR
HYDOXDWHFKDQJHVWRORFDO*HQHUDO3ODQVDQGWKHLPSDFWVRIPDMRUGHYHORSPHQWSURMHFWVIRUWKHLUHIIHFWVRQWKHORFDODQGUHJLRQDO
WUDQVSRUWDWLRQV\VWHPDQGWKHDELOLW\WRDFKLHYHWKH0XOWLPRGDO7UDQVSRUWDWLRQ6HUYLFH2EMHFWLYHVHVWDEOLVKHGLQWKH$FWLRQ3ODQV
-XULVGLFWLRQVVKDOODOVRSDUWLFLSDWHLQWKH$XWKRULW\¶VRQJRLQJFRXQW\ZLGHFRPSUHKHQVLYHWUDQVSRUWDWLRQSODQQLQJSURFHVV$VSDUW
RIWKLVSURFHVVWKH$XWKRULW\VKDOOVXSSRUWFRXQW\ZLGHDQGVXEUHJLRQDOSODQQLQJHIIRUWVLQFOXGLQJWKH$FWLRQPlans for Routes
of Regional Significance, and shall maintain a travel demand model. Jurisdictions shall help maintain the $XWKRULW\¶V
WUDYHOGHPDQGPRGHOLQJV\VWHPE\SURYLGLQJLQIRUPDWLRQRQSURSRVHGLPSURYHPHQWVWRWKHWUDQVSRUWDWLRQV\VWHPDQGSODQQHG
DQGDSSURYHGGHYHORSPHQWZLWKLQWKHMXULVGLFWLRQ
5. Continuously Comply with an Urban Limit Line (ULL)
,QRUGHUWREHIRXQGLQFRPSOLDQFHZLWKWKLVHOHPHQWRIWKH$XWKRULW\¶V*URZWK0DQDJHPHQW3URJUDPDOOMXULVGLFWLRQVPXVW
FRQWLQXDOO\FRPSO\ZLWKDQDSSOLFDEOHYRWHUDSSURYHG8UEDQ/LPLW/LQH 8// 6DLG8//PD\HLWKHUEHWKH&RQWUD&RVWD&RXQW\
YRWHUDSSURYHG8// &RXQW\8// RUDORFDOO\LQLWLDWHGYRWHUDSSURYHG8// /98//
Additional information and detailed compliance requirements for the ULL are fully defined in the ULL Compliance
5HTXLUHPHQWVZKLFKDUHLQFRUSRUDWHGKHUHLQRQSDJH
$Q\RIWKHIROORZLQJDFWLRQVE\DORFDOMXULVGLFWLRQZLOOFRQVWLWXWHQRQFRPSOLDQFHZLWKWKH*URZWK0DQDJHPHQW3URJUDP
7KH VXEPLWWDO RI DQ DQQH[DWLRQ UHTXHVW WR /RFDO $JHQF\ )RUPDWLRQ &RPPLVVLRQ /$)&2 IRU ODQGV RXWVLGH RI D
MXULVGLFWLRQ¶VDSSOLFDEOH8//
)DLOXUHWRFRQIRUPWRWKH$XWKRULW\¶V8//&RPSOLDQFH5HTXLUHPHQWV VHHSDJH
6. Develop a Five-Year Capital Improvement Program
(DFK MXULVGLFWLRQ VKDOO SUHSDUH DQG PDLQWDLQ D FDSLWDO LPSURYHPHQW SURJUDP WKDW RXWOLQHV WKH FDSLWDO SURMHFWV QHHGHG WR
implement the goals and policies of the jurisdiction’s General Plan for at least the following five-year period. The Capital
,PSURYHPHQW3URJUDPVKDOOLQFOXGHDSSURYHGSURMHFWVDQGDQDQDO\VLVRIWKHFRVWVRIWKHSURSRVHGSURMHFWVDVZHOODVDfinancial
plan for providing the improvements. The jurisdiction shall forward the transportation component of its capital
LPSURYHPHQWSURJUDPWRWKH$XWKRULW\IRULQFRUSRUDWLRQLQWRWKH$XWKRULW\¶VGDWDEDVHRIWUDQVSRUWDWLRQSURMHFWV
7. Adopt a Transportation Systems Management (TSM) Ordinance or Resolution
7RSURPRWHFDUSRROVYDQSRROVDQGSDUNDQGULGHORWVHDFKMXULVGLFWLRQVKDOODGRSWDORFDORUGLQDQFHRUUHVROXWLRQWKDWFRQIRUPV
WRWKHPRGHO7UDQVSRUWDWLRQ6\VWHPV0DQDJHPHQW2UGLQDQFHWKDWWKH7UDQVSRUWDWLRQ$XWKRULW\KDVGUDIWHGDQGDGRSWHG8SRQ
DSSURYDORIWKH$XWKRULW\FLWLHVZLWKDVPDOOHPSOR\PHQWEDVHPD\DGRSWDOWHUQDWLYHPLWLJDWLRQPHDVXUHVLQOLHXRID760
RUGLQDQFHRUUHVROXWLRQ
8. Adopt Additional Growth Management Policies, as applicable
(DFK MXULVGLFWLRQ VKDOO DGRSW DQG WKHUHDIWHU FRQWLQXRXVO\ PDLQWDLQ WKH IROORZLQJ SROLFLHV ZKHUH DSSOLFDEOH D KLOOVLGH
GHYHORSPHQWSROLF\DULGJHOLQHSURWHFWLRQSROLF\DZLOGOLIHFRUULGRUSROLF\DQGDFUHHNGHYHORSPHQWSROLF\:KHUHDMXULVGLFWLRQ
GRHVQRWKDYHDGHYHORSDEOHKLOOVLGHULGJHOLQHZLOGOLIHFRUULGRURUFUHHNLWQHHGQRWDGRSWWKHFRUUHVSRQGLQJSROLF\$Q
RUGLQDQFHWKDWLPSOHPHQWVWKH(DVW&RQWUD&RVWD+&31&&3VKDOOVDWLVI\WKHUHTXLUHPHQWWRKDYHDQDGRSWHGZLOGOLIHFRUULGRU
SROLF\DQGFUHHNGHYHORSPHQWSROLF\,QDGGLWLRQWRWKHDERYHMXULVGLFWLRQVZLWK3ULPH)DUPODQGDQGFarmland of Statewide
Importance (as defined by the California Dept. of Conservation and mapped by FMMP) within their SODQQLQJDUHDVEXW
RXWVLGHRIWKHLUFLW\VKDOODGRSWDQGWKHUHDIWHUFRQWLQXRXVO\PDLQWDLQDQ$JULFXOWXUDO3URWHFWLRQ3ROLF\7KHSROLF\PXVWHQVXUH
WKDWSRWHQWLDOLPSDFWVRIFRQYHUWLQJ3ULPH)DUPODQGDQG)DUPODQGRI6WDWHZLGH,PSRUWDQFHoutside the ULL to other uses
are identified and disclosed when considering such a conversion. The applicable policies DUHUHTXLUHGWREHLQSODFHE\
QRODWHUWKDQ$SULO
FFWDQHW11 &RQWUD&RVWD7UDQVSRUWDWLRQ$XWKRULW\T #&&7$fl FFWDQHW\RXWXEH
1.6-906-10-19 TWIC Meeting Agenda
Packet Pg.172 of 192
Growth Management Program
$OORFDWLRQRI)XQGV
3RUWLRQVRIWKHPRQLHVUHFHLYHGIURPWKHUHWDLOWUDQVDFWLRQDQGXVHWD[ZLOOEHUHWXUQHGWRWKHORFDOMXULVGLFWLRQV WKHFLWLHV
DQGWKHFRXQW\ IRUXVHRQORFDOVXEUHJLRQDODQGRUUHJLRQDOWUDQVSRUWDWLRQLPSURYHPHQWVDQGPDLQWHQDQFHSURMHFWV
5HFHLSWRIDOOVXFKIXQGVUHTXLUHVFRPSOLDQFHZLWKWKH*URZWK0DQDJHPHQW3URJUDPDQGWKHDOORFDWLRQSURFHGXUHVGHVFULEHG
EHORZ7KHIXQGVDUHWREHGLVWULEXWHGRQDIRUPXODEDVHGRQSRSXODWLRQDQGURDGPLOHV
(DFK MXULVGLFWLRQ VKDOO GHPRQVWUDWH LWV FRPSOLDQFH ZLWK DOO RIWKH FRPSRQHQWV RI WKH *URZWK 0DQDJHPHQW 3URJUDPin a
completed compliance checklist. The jurisdiction shall submit, and the Authority shall review and make findings
UHJDUGLQJ WKH MXULVGLFWLRQ¶V FRPSOLDQFH ZLWK WKH UHTXLUHPHQWV RI WKH *URZWK 0DQDJHPHQW 3URJUDP FRQVLVWHQW ZLWK WKH
$XWKRULW\¶VDGRSWHGSROLFLHVDQGSURFHGXUHV
,IWKH$XWKRULW\GHWHUPLQHVWKDWWKHMXULVGLFWLRQFRPSOLHVZLWKWKHUHTXLUHPHQWVRIWKH*URZWK0DQDJHPHQW3URJUDPLW
VKDOODOORFDWHWRWKHMXULVGLFWLRQLWVVKDUHRI7UDQVIRUPLQJ&RQWUD&RVWD&RXQW\([SHQGLWXUH3ODQIXQGLQJIURP/RFDO
6WUHHWV0DLQWHQDQFHDQG,PSURYHPHQWVIXQGLQJDQGLWVVKDUHRI&RQWUD&RVWD¶V0HDVXUH-7UDQVSRUWDWLRQ6DOHV7D[
([SHQGLWXUH3ODQ/RFDO6WUHHWV0DLQWHQDQFH ,PSURYHPHQWVIXQGLQJ-XULVGLFWLRQVPD\XVHIXQGVDOORFDWHGXQGHUWKLV
SURYLVLRQWRFRPSO\ZLWKWKHVHDGPLQLVWUDWLYHUHTXLUHPHQWV
,IWKH$XWKRULW\GHWHUPLQHVWKDWWKHMXULVGLFWLRQGRHVQRWFRPSO\ZLWKWKHUHTXLUHPHQWVRIWKH*URZWK0DQDJHPHQW3URJUDP
the Authority shall withhold those funds and also make a finding that the jurisdiction shall not be eligible to receive
2016 7UDQVIRUPLQJ&RQWUD&RVWD&RXQW\([SHQGLWXUH3ODQIXQGLQJIURP&RPPXQLW\'HYHORSPHQW7UDQVSRUWDWLRQ3URJUDPIXQGV
RU&RQWUD&RVWD¶V0HDVXUH-7UDQVSRUWDWLRQ6DOHV7D[([SHQGLWXUH3ODQ7UDQVSRUWDWLRQIRU/LYDEOH&RPPXQLWLHVIXQGVXQWLOWKH
Authority determines the jurisdiction has achieved compliance. The Authority’s findings of noncompliance may set
deadlines DQGFRQGLWLRQVIRUDFKLHYLQJFRPSOLDQFH
:LWKKROGLQJ RI IXQGV UHLQVWDWHPHQW RI FRPSOLDQFH UHDOORFDWLRQRIIXQGVDQGWUHDWPHQWRIXQDOORFDWHGIXQGVVKDOOEHDV
HVWDEOLVKHGLQDGRSWHG$XWKRULW\¶VSROLFLHVDQGSURFHGXUHV
FFWDQHW11 &RQWUD&RVWD7UDQVSRUWDWLRQ$XWKRULW\T #&&7$fl FFWDQHW\RXWXEH
1.6-1006-10-19 TWIC Meeting Agenda
Packet Pg.173 of 192
85%$1/,0,7/,1( 8//
&203/,$1&(5(48,5(0(176
Definitions—the following definitions apply to the GMP ULL requirement:
8UEDQ/LPLW/LQH 8// $QXUEDQOLPLWOLQHXUEDQJURZWKERXQGDU\RURWKHUHTXLYDOHQWSK\VLFDOERXQGDU\MXGJHGE\WKH
$XWKRULW\WRFOHDUO\LGHQWLI\WKHSK\VLFDOOLPLWVRIWKHORFDOMXULVGLFWLRQ¶VIXWXUHXUEDQGHYHORSPHQW
/RFDO -XULVGLFWLRQV ,QFOXGHV &RQWUD &RVWD &RXQW\ WKH FLWLHV DQG WRZQV ZLWKLQ &RQWUD &RVWD SOXV DQ\ QHZO\
LQFRUSRUDWHGFLWLHVRUWRZQVHVWDEOLVKHGDIWHU$SULO
&RXQW\8// $8//SODFHGRQWKHEDOORWE\WKH&RQWUD&RVWD&RXQW\%RDUGRI6XSHUYLVRUVDSSURYHGE\YRWHUVDWD
FRXQW\ZLGHHOHFWLRQDQGLQHIIHFWWKURXJKWKHDSSOLFDEOH*03F RPSOLDQFHSHULRG7KHFXUUHQW&RXQW\8//ZDVHVWDEOLVKHG
E\0HDVXUH/DSSURYHGE\YRWHUVLQ
The following local jurisdictions have adopted the County ULL as their applicable ULL:
&LW\RI%UHQWZRRG 7RZQRI0RUDJD
&LW\RI&OD\WRQ&LW\RI2DNOH\
&LW\RI&RQFRUG&LW\RI2ULQGD
7RZQRI'DQYLOOH &LW\RI3LQROH
&LW\RI(O&HUULWR&LW\RI3OHDVDQW+LOO
&LW\RI+HUFXOHV&LW\RI5LFKPRQG
&LW\RI/DID\HWWH&LW\RI6DQ3DEOR
&LW\RI0DUWLQH]&LW\RI:DOQXW&UHHN
/RFDO 9RWHU 8// /98// $ 8// RU HTXLYDOHQW PHDVXUH SODFHGRQ WKH ORFDO MXULVGLFWLRQ EDOORW DSSURYHG E\ WKH
MXULVGLFWLRQ¶VYRWHUVDQGUHFRJQL]HGE\DFWLRQRIWKHORFDOMXULVGLFWLRQ¶VOHJLVODWLYHERG\DVLWVDSSOLFDEOHYRWHUDSSURYHG
8//7KH/98//ZLOOEHXVHGDVRILWVHIIHFWLYHGDWHWRPHHWWKH$XWKRULW\¶V*038//UHTXLUHPHQWDQGPXVWEHLQHIIHFW
WKURXJKWKHDSSOLFDEOH*03FRPSOLDQFHSHULRG
The following local jurisdictions have adopted a LV-ULL:
&LW\RI$QWLRFK
&LW\RI6DQ5DPRQ
&LW\RI3LWWVEXUJ
0LQRU$GMXVWPHQW $QDGMXVWPHQWWRWKH8//RIDFUHVRUOHVVLVLQWHQGHGWRDGGUHVVXQDQWLFLSDWHGFLUFXPVWDQFHV
2WKHU$GMXVWPHQWV 2WKHUDGMXVWPHQWVWKDWDGGUHVVLVVXHVRIXQFRQVWLWXWLRQDOWDNLQJVDQGFRQIRUPDQFHWRVWDWHDQG
IHGHUDOODZ
5HYLVLRQVWRWKH8//
$ORFDOMXULVGLFWLRQZKLFKKDVDGRSWHGWKH&RXQW\8//DVLWVDSSOLFDEOH8//PD\UHYLVHLWV8//ZLWKORFDOYRWHUDSSURYDO
DWDQ\WLPHGXULQJWKHWHUPRIWKH$XWKRULW\¶V*03E\DGRSWLQJD/98//LQDFFRUGDQFHZLWKWKHrequirements outlined
for a LV-ULL contained in the definitions section.
$ORFDOMXULVGLFWLRQPD\UHYLVHLWV/98//ZLWKORFDOYRWHUDSSURYDODWDQ\WLPHGXULQJWKHWHUPRIWKH$XWKRULW\¶VGMP if
the resultant ULL meets the requirements outlined for a LV-ULL contained in the definitions section.
FFWDQHW11 &RQWUD&RVWD7UDQVSRUWDWLRQ$XWKRULW\T #&&7$fl FFWDQHW\RXWXEH
1.6-1106-10-19 TWIC Meeting Agenda
Packet Pg.174 of 192
8UEDQ/LPLW/LQH 8// &RPSOLDQFH5HTXLUHPHQWV
,IYRWHUVWKURXJKDFRXQW\ZLGHEDOORWPHDVXUHDSSURYHDUHYLVLRQWRWKH&RXQW\8//WKHOHJLVODWLYHERG\RIHDFKORFDO
MXULVGLFWLRQUHO\LQJRQWKH&RXQW\8//VKDOO
D $FFHSWDQGDSSURYHLWVH[LVWLQJ8//WRFRQWLQXHDVLWVDSSOLFDEOH8//RU
E $FFHSWDQGDSSURYHWKHUHYLVHG&RXQW\8//DVLWVDSSOLFDEOH8//RU
FAdopt a LV-ULL in accordance with the requirements outlined for a LV-ULL contained in the definitions section.
/RFDOMXULVGLFWLRQVPD\ZLWKRXWYRWHUDSSURYDOHQDFW0LQRU$GMXVWPHQWVWRWKHLUDSSOLFDEOH8//VXEMHFWWRDYRWHRIDW
OHDVWRIWKHMXULVGLFWLRQ¶VOHJLVODWLYHERG\DQGPHHWLQJWKHIROORZLQJUHTXLUHPHQWV
D 0LQRUDGMXVWPHQWVKDOOQRWH[FHHGDFUHV
EAdoption of at least one of the findings listed in the County’s Measure L (§82-1.018 of County Ordinances
200606 § 3, 91-1 § 2, 90-66 § 4) which include:
x $QDWXUDORUPDQPDGHGLVDVWHURUSXEOLFHPHUJHQF\KDVRFFXUUHGZKLFKZDUUDQWVWKHSURYLVLRQRIKRXVLQJDQGRU
RWKHUFRPPXQLW\QHHGVZLWKLQODQGORFDWHGRXWVLGHWKHXUEDQOLPLWOLQH
x $QREMHFWLYHVWXG\KDVGHWHUPLQHGWKDWWKHXUEDQOLPLWOLQHLVSUHYHQWLQJWKHMXULVGLFWLRQIURPSURYLGLQJLWVIDLU
VKDUHRIDIIRUGDEOHKRXVLQJRUUHJLRQDOKRXVLQJDVUHTXLUHGE\VWDWHODZDQGWKHJRYHUQLQJHOHFWHGlegislative
body finds that a change to the urban limit line is necessary and the only feasible means to HQDEOHWKH
FRXQW\MXULVGLFWLRQWRPHHWWKHVHUHTXLUHPHQWVRIVWDWHODZ
x $PDMRULW\RIWKHFLWLHVWKDWDUHSDUW\WRDSUHVHUYDWLRQDJUHHPHQWDQGWKHFRXQW\KDYHDSSURYHGDFKDQJHWRWKH
XUEDQOLPLWOLQHDIIHFWLQJDOORUDQ\SRUWLRQRIWKHODQGFRYHUHGE\WKHSUHVHUYDWLRQDJUHHPHQW
x A minor change to the urban limit line will more accurately reflect topographical characteristics or legal
ERXQGDULHV
x A five-year cyclical review of the urban limit line has determined, based on the criteria and factors
for HVWDEOLVKLQJWKHXUEDQOLPLWOLQHVHWIRUWKLQ&RQWUD&RVWD&RXQW\&RGH 6HFWLRQ WKDWQHZ
LQIRUPDWLRQ LV DYDLODEOH IURP FLW\ WRZQ RU FRXQW\ JURZWK PDQDJHPHQW VWXGLHV RU RWKHUZLVH RU
FLUFXPVWDQFHVKDYHFKDQJHGZDUUDQWLQJDFKDQJHWRWKHXUEDQOLPLWOLQH
x $QREMHFWLYHVWXG\KDVGHWHUPLQHGWKDWDFKDQJHWRWKHXUEDQOLPLWOLQHLVQHFHVVDU\RUGHVLUDEOHWRIXUWKHUWKH
HFRQRPLF YLDELOLW\ RI WKH (DVW &RQWUD &RVWD &RXQW\ $LUSRUW DQGHLWKHU L PLWLJDWHDGYHUVHDYLDWLRQUHODWHG
HQYLURQPHQWDORUFRPPXQLW\LPSDFWVDWWULEXWDEOHWR%XFKDQDQ)LHOGRU LL IXUWKHUWKHFRXQW\¶VDYLDWLRQUHODWHG
QHHGV RU
x $FKDQJHLVUHTXLUHGWRFRQIRUPWRDSSOLFDEOH&DOLIRUQLDRUIHGHUDOODZ
c. Adoption of a finding that the proposed Minor Adjustment will have a public benefit. Said public benefit could
LQFOXGH EXW LV QRW QHFHVVDULO\ OLPLWHG WR HQKDQFHG PRELOLW\ RISHRSOHRUJRRGVHQYLURQPHQWDOSURWHFWLRQVRU
HQKDQFHPHQWVLPSURYHGDLUTXDOLW\RUODQGXVHHQKDQFHGSXEOLFVDIHW\RUVHFXULW\KRXVLQJRUMREVLQIUDVWUXFWXUH
preservation or other significant positive community effects as defined by the local land use authority. If the
SURSRVHG0LQRU$GMXVWPHQWWRWKH8//LVSURSRVHGWRDFFRPPRGDWHKRXVLQJRUFRPPHUFLDOGHYHORSPHQWVDLGSURSRVDO
PXVWLQFOXGHSHUPDQHQWHQYLURQPHQWDOSURWHFWLRQVRUHQKDQFHPHQWVVXFKDVWKHSHUPDQHQWSURWHFWLRQRIDJULFXOWXUDO
ODQGVWKHGHGLFDWLRQRIRSHQVSDFHRUWKHHVWDEOLVKPHQWRISHUPDQHQWFRQVHUYDWLRQHDVHPHQWV
d.7KH0LQRU$GMXVWPHQWLVQRWFRQWLJXRXVWRRQHRUPRUHQRQYRWHUDSSURYHG0LQRU$GMXVWPHQWVWKDWLQWRWDOH[FHHG
DFUHV
e. The Minor Adjustment does not create a pocket of land outside the existing urban limit line, specifically to avoid
the possibility of a jurisdiction wanting to fill in those subsequently through separate adjustments.
FFWDQHW11 &RQWUD&RVWD7UDQVSRUWDWLRQ$XWKRULW\T #&&7$fl FFWDQHW\RXWXEH
1.6-1206-10-19 TWIC Meeting Agenda
Packet Pg.175 of 192
8UEDQ/LPLW/LQH 8// &RPSOLDQFH5HTXLUHPHQWV
I $Q\MXULVGLFWLRQSURSRVLQJWRSURFHVVDPLQRUDGMXVWPHQWWRLWVDSSOLFDEOH8//WKDWLPSDFWV3ULPH)DUPODQGDQG)DUPODQG
RI6WDWHZLGH,PSRUWDQFH DVGHILQHGE\WKH&DOLIRUQLD'HSWRI&RQVHUYDWLRQDQGPDSSHGE\)003 LVUHTXLUHGWRKDYH
DQDGRSWHG$JULFXOWXUDO3URWHFWLRQ2UGLQDQFHRUPXVWGHPRQVWUDW HKRZWKHORVVRIWKHVHDJULFXOWXUDOODQGVZLOOEHPLWLJDWHG
E\SHUPDQHQWO\SURWHFWLQJIDUPODQG
$ORFDOMXULVGLFWLRQPD\UHYLVHLWV/98//DQGWKH&RXQW\PD\UHYLVHWKH&RXQW\8//WRDGGUHVVLVVXHVRIXQFRQVWLWXWLRQDO
WDNLQJVRUFRQIRUPDQFHWR6WDWHRUIHGHUDOODZ
&RQGLWLRQVRI&RPSOLDQFH
6XEPLWWDORIDQDQQH[DWLRQUHTXHVWRIJUHDWHUWKDQDFUHVE\DORFDOMXULVGLFWLRQWR/$)&2RXWVLGHRIDYRWHUDSSURYHG
8//ZLOOFRQVWLWXWHQRQFRPSOLDQFHZLWKWKH*03
)RUHDFKMXULVGLFWLRQDQDSSOLFDEOH8//VKDOOEHLQSODFHWKURXJKHDFK*03FRPSOLDQFHUHSRUWLQJSHULRGLQRUGHUIRUWKH
ORFDOMXULVGLFWLRQWREHIRXQGLQFRPSOLDQFHZLWKWKH*03UHTXLUHPHQWV
FFWDQHW&RQWUD&RVWD7UDQVSRUWDWLRQ$XWKRULW\7#&&7$IOFFWDQHW\RXWXEH
1.6-1306-10-19 TWIC Meeting Agenda
Packet Pg.176 of 192
&203/(7(675((7632/,&<
Vision
7KLV3ODQHQYLVLRQVDWUDQVSRUWDWLRQV\VWHPLQZKLFKHDFKFRPSRQHQWSURYLGHVVDIHFRPIRUWDEOHDQGFRQYHQLHQWDFFHVV
IRUHYHU\XVHUDOORZHGWRXVHLW7KHVHXVHUVLQFOXGHSHGHVWULDQVELF\FOLVWVWUDQVLWULGHUVDXWRPRELOHGULYHUVDQGWKHLU
SDVVHQJHUVDQGWUXFNHUVDQGSHRSOHRIYDU\LQJDELOLWLHVLQFOXGLQJFKLOGUHQVHQLRUVSHRSOHZLWKGLVDELOLWLHVDQGDEOH
ERGLHGDGXOWV7KHJRDORIHYHU\WUDQVSRUWDWLRQSURMHFWLVWRSURYLGHVDIHUPRUHDFFHVVLEOHIDFLOLWLHVIRUDOOXVHUVDQGDOO
SURMHFWVVKDOOEHSODQQHGGHVLJQHGFRQVWUXFWHGDQGRSHUDWHGWRWDNHDGYDQWDJHRIWKDWRSSRUWXQLW\
By making streets more efficient and safe for all users, a complete streets approach will expand capacity and improve
PRELOLW\IRUDOOXVHUVJLYLQJFRPPXWHUVFRQYHQLHQWRSWLRQVIRUWUDYHODQGPLQLPL]LQJWKHQHHGWRZLGHQURDGZD\V
Policy
7RDFKLHYHWKLVYLVLRQDOOUHFLSLHQWVRIIXQGLQJWKURXJKWKLV3ODQVKDOOFRQVLGHUDQGDFFRPPRGDWHZKHUHYHUSRVVLEOHDQGVXEMHFW
WRWKH([FHSWLRQVOLVWHGLQWKLV3ROLF\WKHQHHGVRIDOOXVHUVLQWKHSODQQLQJGHVLJQFRQVWUXFWLRQUHFRQVWUXFWLRQUHKDELOLWDWLRQ
DQGPDLQWHQDQFHRIWKHWUDQVSRUWDWLRQV\VWHP7KLVGHWHUPLQDWLRQVKDOOEHFRQVLVWHQWZLWKWKHH[FHSWLRQVOLVWHGEHORZ$FKLHYLQJ
WKLVYLVLRQZLOOUHTXLUHEDODQFLQJWKHQHHGVRIGLIIHUHQWXVHUVDQGPD\UHTXLUHUHDOORFDWLQJH[LVWLQJULJKWRIZD\IRUGLIIHUHQW
XVHV
7KH$XWKRULW\VKDOOUHYLVHLWVSURMHFWGHYHORSPHQWJXLGHOLQHVWRUHTXLUHWKHFRQVLGHUDWLRQDQGDFFRPPRGDWLRQRIDOOXVHUVLQWKH
GHVLJQDQGFRQVWUXFWLRQRISURMHFWVIXQGHGZLWK0HDVXUHIXQGVDQGVKDOODGRSWSHHUUHYLHZDQGGHVLJQstandards to implement
that approach. The guidelines will allow flexibility in responding to the context of each project and the needs of users
specific to the project’s context, and will build on accepted best practices for complete streets DQGFRQWH[WVHQVLWLYH
GHVLJQ
7RHQVXUHWKDWWKLVSROLF\LVFDUULHGRXWWKH$XWKRULW\VKDOOSUHSDUHDFKHFNOLVWWKDWVSRQVRUVRISURMHFWVXVLQJ0HDVXUH
IXQGVPXVWVXEPLWWKDWGRFXPHQWVKRZWKHQHHGVRIDOOXVHUVZHUHFRQVLGHUHGDQGKRZWKH\ZHUHDFFRPPRGDWHGLQWKH
GHVLJQDQGFRQVWUXFWLRQRIWKHSURMHFW,QWKHFKHFNOLVWWKHVSRQVRUZLOORXWOLQHKRZWKH\SURYLGHGRSSRUWXQLW\IRUSXEOLF
LQSXWLQDSXEOLFIRUXPIURPDOOXVHUVHDUO\LQWKHSURMHFWGHYHORSPHQWDQGGHVLJQSURFHVV,IWKHSURSRVHGSURMHFWRU
SURJUDPZLOOQRWSURYLGHFRQWH[WDSSURSULDWHFRQGLWLRQVIRUDOOXVHUVWKHVSRQVRUVKDOOGRFXPHQWWKHUHDVRQVZK\LQWKH
FKHFNOLVWFRQVLVWHQWZLWKWKHIROORZLQJVHFWLRQRQ³H[FHSWLRQV´EHORZ7KHFRPSOHWHGFKHFNOLVWVKDOOEHPDGHSDUWRIWKH
DSSURYDORISURJUDPPLQJRIIXQGLQJIRUWKHSURMHFWRUWKHIXQGLQJDOORFDWLRQUHVROXWLRQ
5HFLSLHQWVRI/RFDO0DLQWHQDQFHDQG,PSURYHPHQWVIXQGVVKDOODGRSWSURFHGXUHVWKDWHQVXUHWKDWDOODJHQF\GHSDUWPHQWV
FRQVLGHUDQGDFFRPPRGDWHWKHQHHGVRIDOOXVHUVIRUSURMHFWVRUSURJUDPVDIIHFWLQJSXEOLFULJKWVRIZD\IRUZKLFKWKHDJHQF\
LVUHVSRQVLEOH7KHVHSURFHGXUHVVKDOO
EHFRQVLVWHQWZLWKDQGEHGHVLJQHGWRLPSOHPHQWHDFKDJHQF\¶VJHQHUDOSODQSROLFLHVRQFHWKDWSODQKDVEHHQXSGDWHG
WRFRPSO\ZLWKWKH&RPSOHWH6WUHHWV$FWRI
LQYROYHDQGFRRUGLQDWHWKHZRUNRIDOODJHQF\GHSDUWPHQWVDQGVWDIIZKRVHSURMHFWVZLOODIIHFWWKHSXEOLFULJKWRIZD\
FRQVLGHUWKHFRPSOHWHVWUHHWGHVLJQVWDQGDUGVDGRSWHGE\WKH$XWKRULW\DQG
SURYLGHRSSRUWXQLW\IRUSXEOLFUHYLHZE\DOOSRWHQWLDOXVHUVHDUO\LQWKHSURMHFWGHYHORSPHQWDQGGHVLJQSKDVHVRWKDW
RSWLRQVFDQEHIXOO\FRQVLGHUHG7KLVUHYLHZFRXOGEHGRQHWKURXJKDQDGYLVRU\FRPPLWWHHVXFKDVD%LF\FOHDQG
3HGHVWULDQ$GYLVRU\&RPPLWWHHRUDVSDUWRIWKHUHYLHZRIWKHDJHQF\¶VFDSLWDOLPSURYHPHQWSURJUDP
$VSDUWRIWKHLUELHQQLDO*URZWK0DQDJHPHQW3URJUDPFKHFNOLVWDJHQFLHVVKDOOOLVWSURMHFWVIXQGHGE\WKH0HDVXUHDQGGHWDLO
KRZWKRVHSURMHFWVDFFRPPRGDWHGXVHUVRIDOOPRGHV
FFWDQHW11 &RQWUD&RVWD7UDQVSRUWDWLRQ$XWKRULW\T #&&7$fl FFWDQHW\RXWXEH
1.6-1406-10-19 TWIC Meeting Agenda
Packet Pg.177 of 192
&RPSOHWH6WUHHWV3ROLF\
$VSDUWRIWKHPXOWLMXULVGLFWLRQDOSODQQLQJUHTXLUHGE\WKH*URZWK0DQDJHPHQW3URJUDPDJHQFLHVVKDOOZRUNZLWKWKH$XWKRULW\
DQGWKH5HJLRQDO7UDQVSRUWDWLRQ3ODQQLQJ&RPPLWWHHVWRKDUPRQL]HWKHSODQQLQJGHVLJQDQGFRQVWUXFWLRQRIWUDQVSRUWDWLRQ
IDFLOLWLHVIRUDOOPRGHVZLWKLQWKHLUMXULVGLFWLRQZLWKWKHSODQVRIDGMRLQLQJDQGFRQQHFWLQJMXULVGLFWLRQV
Exceptions
3URMHFWVSRQVRUVPD\SURYLGHDOHVVHUDFFRPPRGDWLRQRUIRUJRFRPSOHWHVWUHHWDFFRPPRGDWLRQFRPSRQHQWVZKHQWKHpublic
works director or equivalent agency official finds that:
3HGHVWULDQVELF\FOLVWVRURWKHUXVHUVDUHSURKLELWHGE\ODZIURPXVLQJWKHWUDQVSRUWDWLRQIDFLOLW\
7KHFRVWRIQHZDFFRPPRGDWLRQZRXOGEHH[FHVVLYHO\GLVSURSRUWLRQDWHWRWKHQHHGRUSUREDEOHXVHRU
7KHVSRQVRUGHPRQVWUDWHVWKDWVXFKDFFRPPRGDWLRQLVQRWQHHGHGEDVHGRQREMHFWLYHIDFWRUVLQFOXGLQJ
D FXUUHQWDQGSURMHFWHGXVHUGHPDQGIRUDOOPRGHVEDVHGRQFXUUHQWDQGIXWXUHODQGXVHDQG
Elack of identified conflicts, both existing and potential, between modes of travel.
Project sponsors shall explicitly approve exceptions findings as part of the approval of any project using measure
funds to improve streets classified as a major collector or above.3ULRUWRWKLVSURMHFWVSRQVRUVPXVWSURYLGHDQ
RSSRUWXQLW\IRUSXEOLFLQSXWDWDQDSSURYDOERG\ WKDWUHJXODUO\FRQVLGHUVGHVLJQLVVXHV DQGRUWKHJRYHUQLQJERDUGRIWKH
SURMHFWVSRQVRU
Major Collectors and above, as defined by the California Department of Transportation California Road System &56
PDSV
FFWDQHW11 &RQWUD&RVWD7UDQVSRUWDWLRQ$XWKRULW\T #&&7$fl FFWDQHW\RXWXEH
1.6-1506-10-19 TWIC Meeting Agenda
Packet Pg.178 of 192
$'9$1&(0,7,*$7,21352*5$0
7KH$XWKRULW\LVFRPPLWWHGWRSDUWLFLSDWHLQWKHFUHDWLRQDQGIXQGLQJRIDQ$GYDQFH0LWLJDWLRQ3URJUDPDVDQLQQRYDWLYHway to
advance needed infrastructure projects more efficiently and provide more effective conservation of our natural UHVRXUFHV
ZDWHUVKHGVDQGZHWODQGVDQGDJULFXOWXUDOODQGV$VDJOREDOELRGLYHUVLW\KRWVSRWWKH%D\$UHDDQG&RQWUD&RVWD&RXQW\KRVWV
DQH[WUDRUGLQDULO\ULFKDUUD\RIYDOXDEOHQDWXUDOFRPPXQLWLHVDQGHFRV\VWHPVWKDWSURYLGHKDELWDWIRUUDUHSODQWVDQGZLOGOLIHDQG
VXSSRUWUHVLGHQWV¶KHDOWKDQGTXDOLW\RIOLIHE\SURYLGLQJFOHDQGULQNLQJZDWHUFOHDQair, opportunities for outdoor recreation,
protection from disasters like flooding, landslides, and adaptation to climate FKDQJH7KH$GYDQFH0LWLJDWLRQ3URJUDPDLPV
WRLQWHJUDWHFRQVHUYDWLRQLQWRLQIUDVWUXFWXUHDJHQFLHV¶SODQVDQGSURMHFWGHYHORSPHQWZHOOLQDGYDQFHDQGRQDUHJLRQDOVFDOHWR
UHGXFHSRWHQWLDOLPSDFWVRIWUDQVSRUWDWLRQSURMHFWVDVZHOODV WRGULYHPLWLJDWLRQGROODUVWRSURWHFWUHJLRQDOFRQVHUYDWLRQSULRULWLHV
DQGSURWHFWLPSRUWDQWHFRORJLFDOIXQFWLRQVZDWHUVKHGVDQGZHWODQGVDQGDJULFXOWXUDOODQGVWKDWDUHDWWKUHDWRIORVV7KH$GYDQFH
0LWLJDWLRQ3URJUDPZLOOSURYLGHHQYLURQPHQWDOmitigation activities specifically required under the California Environmental
Quality Act (CEQA), National Environmental 3ROLF\$FW 1(3$ &OHDQ:DWHU$FW6HFWLRQDQG6HFWLRQDQGRWKHU
DSSOLFDEOHUHJXODWLRQVLQWKHLPSOHPHQWDWLRQof the major highway, transit and regional arterial and local streets and roads
projects identified in the Plan.
7KH$XWKRULW\¶VSDUWLFLSDWLRQLQDQ$GYDQFH0LWLJDWLRQ3URJUDPLVVXEMHFWWRWKHIROORZLQJFRQGLWLRQV
1. Development of a Regional Conservation Assessment/Framework that identifies conservation priorities
and PLWLJDWLRQRSSRUWXQLWLHVIRUDOORI&RQWUD&RVWD&RXQW\7KH5HJLRQDO&RQVHUYDWLRQ$VVHVVPHQW)UDPHZRUN
ZLOOLQFOXGHFRXQW\ZLGHRSSRUWXQLWLHVDQGVWUDWHJLHVWKDWDUHDPRQJRWKHUUHTXLUHPHQWVFRQVLVWHQWZLWKDQG
VXSSRUWWKH(DVW&RQWUD&RVWD&RXQW\+DELWDW&RQVHUYDWLRQ3ODQ1DWXUDO&RPPXQLW\&RQVHUYDWLRQ3ODQ (DVW
&RQWUD&RVWD+&31&&3 IRUWKHDUHDVRIWKHFRXQW\FRYHUHGE\WKH(DVW&RQWUD&RVWD+&31&&37KH5HJLRQDO
&RQVHUYDWLRQ$VVHVVPHQW)UDPHZRUNZLOOLGHQWLI\PLWLJDWLRQRSSRUWXQLWLHVIRUDOODUHDVRIWKHFRXQW\WRHQVXUH
WKDWPLWLJDWLRQRFFXUVLQWKHYLFLQLW\RIWKHSURMHFWLPSDFWWRWKHJUHDWHVWH[WHQWSRVVLEOH7KH$XWKRULW\ZLOO
UHYLHZDQGDSSURYHWKH5HJLRQDO&RQVHUYDWLRQ$VVHVVPHQW)UDPHZRUNLQFRQVXOWDWLRQZLWKWKH573&VSULRUWR
WKHDOORFDWLRQRIIXQGVIRU$GYDQFH0LWLJDWLRQ3URJUDP
2. Development of a Project Impacts Assessment that identifies the portfolio of projects to be included in
the $GYDQFH0LWLJDWLRQ3URJUDPDQGWKHHVWLPDWHGFRVWVIRUPLWLJDWLRQRIWKHHQYLURQPHQWDOLPSDFWVRIWKH
SURMHFWV7KH$XWKRULW\ZLOOUHYLHZDQGDSSURYHWKH3URMHFW,PSDFWV$VVHVVPHQWSULRUWRWKHDOORFDWLRQRIIXQGV
IRUWKH$GYDQFH0LWLJDWLRQ3URJUDP7KH$VVHVVPHQWDQGHVWLPDWHGFRVWVGRQRWLQDQ\ZD\OLPLWWKHDPRXQWRI
PLWLJDWLRQWKDWPD\EHQHFHVVDU\RUXQGHUWDNHQIRUWKHHQYLURQPHQWDOLPSDFWVRIWKHSURMHFWV
3.'HYHORSPHQWRIWKHOHJLVODWLYHDQGUHJXODWRU\IUDPHZRUNQHFHVVDU\WRLPSOHPHQWDQ$GYDQFH0LWLJDWLRQ
3URJUDPLQ&RQWUD&RVWD&RXQW\
4. The identification of the Implementing Agency to administer the Advance Mitigation Program for Contra
Costa &RXQW\RUSRUWLRQVRIWKH%D\$UHD,QFOXGLQJ&RQWUD&RVWD&RXQW\
7KH$XWKRULW\ZLOOGHWHUPLQHWKHDPRXQWRIIXQGVWREHGHGLFDWHGWRWKLV3URJUDPIROORZLQJWKHVDWLVIDFWLRQRIWKHDERYH
FRQGLWLRQV)XQGVIURPWKH3ODQZLOOEHDOORFDWHGFRQVLVWHQWZLWKWKH5HJLRQDO&RQVHUYDWLRQ$VVHVVPHQW)UDPHZRUNWRIXQG
HQYLURQPHQWDOPLWLJDWLRQDFWLYLWLHVUHTXLUHGLQWKHLPSOHPHQWDWLRQRIWKHPDMRUKLJKZD\WUDQVLWDQGUHJLRQDODUWHULDOand local
streets and roads projects identified in the Plan. If this approach cannot be fully implemented, these funds shall EH
XVHG IRU HQYLURQPHQWDO PLWLJDWLRQ SXUSRVHV RQ D SURMHFW E\ SURMHFW EDVLV 0LWLJDWLRQ UHTXLUHG IRU IXWXUH WUDQVSRUWDWLRQ
improvements identified in the Plan are not limited by the availability of funding or mitigation credits available in the
3URJUDP
FFWDQHW11 &RQWUD&RVWD7UDQVSRUWDWLRQ$XWKRULW\T #&&7$fl FFWDQHW\RXWXEH
1.6-1606-10-19 TWIC Meeting Agenda
Packet Pg.179 of 192
$GYDQFH0LWLJDWLRQ3URJUDP
3URMHFWVIXQGHGIURPWKHIROORZLQJFDWHJRULHVRI([SHQGLWXUHVDUHHOLJLEOHIRULQFOXVLRQLQWKH$GYDQFH0LWLJDWLRQ
3URJUDP
x Major Streets, Complete Streets and Traffic Synchronization Project Grants
x (DVW&RQWUD&RVWD7UDQVLW([WHQVLRQ
x +LJK&DSDFLW\7UDQVLW,PSURYHPHQWVDORQJWKH,&RUULGRULQ:HVW&RQWUD&RVWD&RXQW\
x Traffic Flow Improvements Along I-680 and SR 24
x Traffic Flow Improvements Along SR 242 and SR 4
x ,,QWHUFKDQJH,PSURYHPHQWVDW6DQ3DEOR'DP5RDGDQG&HQWUDO$YH
x ,DQG65,QWHUFKDQJH,PSURYHPHQWV
x (DVW&RXQW\&RUULGRU 9DVFR5RDGDQGRU%\URQ+LJKZD\&RUULGRUV
x 3HGHVWULDQ%LF\FOHDQG7UDLO)DFLOLWLHV
x &RPPXQLW\'HYHORSPHQW7UDQVSRUWDWLRQ3URJUDP
FFWDQHW11 &RQWUD&RVWD7UDQVSRUWDWLRQ$XWKRULW\T #&&7$fl FFWDQHW\RXWXEH
1.6-1706-10-19 TWIC Meeting Agenda
Packet Pg.180 of 192
7$;3$<(56$)(*8$5'6$1'$&&2817$%,/,7<
*29(51,1*6758&785(
Governing Body and Administration
The Authority is governed by a Board composed of 11 members, all elected officials, with the following representation:
x 7ZRPHPEHUVIURPWKH&HQWUDO&RXQW\5HJLRQDO7UDQVSRUWDWLRQ3ODQQLQJ&RPPLVVLRQ 573& DOVRUHIHUUHGWRDV
75$163$&
x 7ZRPHPEHUVIURPWKH(DVW&RXQW\573&DOVRUHIHUUHGWRDV75$163/$1
x 7ZRPHPEHUVIURPWKH6RXWKZHVW&RXQW\573&DOVRUHIHUUHGWRDV6:$7
x 7ZRPHPEHUVIURPWKH:HVW&RXQW\573&DOVRUHIHUUHGWRDV:&&7$&
x 2QHPHPEHUIURPWKH&RQIHUHQFHRI0D\RUV
x 7ZRPHPEHUVIURPWKH%RDUGRI6XSHUYLVRUV
The Authority Board also includes three (3) ex-officio, non-voting members, appointed by the MTC, BART and
the 3XEOLF7UDQVLW2SHUDWRUVLQ&RQWUD&RVWD&RXQW\
7KHIRXUVXEUHJLRQVZLWKLQ&RQWUD&RVWD &HQWUDO:HVW6RXWKZHVWDQG(DVW&RXQW\DUHHDFKUHSUHVHQWHGE\D
5HJLRQDO7UDQVSRUWDWLRQ3ODQQLQJ&RPPLVVLRQ 573& &HQWUDO&RXQW\ 75$163$&VXEUHJLRQ LQFOXGHV&OD\WRQ
&RQFRUG0DUWLQH]3OHDVDQW+LOO:DOQXW&UHHNDQGWKHXQLQFRUSRUDWHGSRUWLRQVRI&HQWUDO&RXQW\:HVW&RXQW\
:&&7$&VXEUHJLRQ LQFOXGHV(O&HUULWR+HUFXOHV3LQROH5LFKPRQG6DQ3DEORDQGWKHXQLQFRUSRUDWHGSRUWLRQVRI
:HVW&RXQW\6RXWKZHVW&RXQW\ 6:$7VXEUHJLRQ LQFOXGHV'DQYLOOH/DID\HWWH0RUDJD2ULQGD6DQ5DPRQDQGWKH
XQLQFRUSRUDWHGSRUWLRQVRI6RXWKZHVW&RXQW\(DVW&RXQW\ 75$163/$1VXEUHJLRQ LQFOXGHV$QWLRFK%UHQWZRRG
2DNOH\3LWWVEXUJDQGWKHXQLQFRUSRUDWHGSRUWLRQVRI(DVW&RXQW\
Public Oversight Committee
7KH3XEOLF2YHUVLJKW&RPPLWWHH &RPPLWWHH VKDOOSURYLGHGLOLJHQWLQGHSHQGHQWDQGSXEOLFRYHUVLJKWRIDOOH[SHQGLWXUHVRI
0HDVXUHIXQGVE\$XWKRULW\RUUHFLSLHQWDJHQFLHV &RXQW\FLWLHVDQGWRZQVWUDQVLWRSHUDWRUVHWF 7KH&RPPLWWHHZLOOUHSRUW
WRWKHSXEOLFDQGIRFXVLWVRYHUVLJKWRQWKH
x 5HYLHZRIDOORFDWLRQDQGH[SHQGLWXUHRI0HDVXUHIXQGVWRHQVXUHWKDWDOOIXQGVDUHXVHGFRQVLVWHQWZLWKWKH
0HDVXUH
x Review of fiscal audits of Measure expenditures.
x 5HYLHZRISHUIRUPDQFHDXGLWVRISURMHFWVDQGSURJUDPVUHODWLYHWRSHUIRUPDQFHFULWHULDHVWDEOLVKHGE\WKH
$XWKRULW\DQGLISHUIRUPDQFHRIDQ\SURMHFWRUSURJUDPGRHVQRWPHHWLWVHVWDEOLVKHGSHUIRUPDQFHFULWHULD
LGHQWLI\UHDVRQVZK\DQGPDNHUHFRPPHQGDWLRQVIRUFRUUHFWLYHDFWLRQVWKDWFDQEHWDNHQE\WKH$XWKRULW\%RDUG
IRUFKDQJHVWRSURMHFWRUSURJUDPJXLGHOLQHV
x 5HYLHZRIDSSOLFDWLRQRIWKH3HUIRUPDQFHEDVHG5HYLHZSROLF\
x 5HYLHZRIWKHPDLQWHQDQFHRIHIIRUWFRPSOLDQFHUHTXLUHPHQWVRIORFDOMXULVGLFWLRQVIRUORFDOVWUHHWVURDGVDQG
EULGJHVIXQGLQJ
x 5HYLHZRIHDFKMXULVGLFWLRQ¶V*URZWK0DQDJHPHQW&KHFNOLVWDQGFRPSOLDQFHZLWKWKH*URZWK0DQDJHPHQW3ODQ
SROLFLHV
FFWDQHW11 &RQWUD&RVWD7UDQVSRUWDWLRQ$XWKRULW\T #&&7$fl FFWDQHW\RXWXEH
1.6-1806-10-19 TWIC Meeting Agenda
Packet Pg.181 of 192
7D[SD\HU6DIHJXDUGVDQG$FFRXQWDELOLW\
7KH&RPPLWWHHVKDOOSUHSDUHDQDQQXDOUHSRUWLQFOXGLQJDQDFFRXQWRIWKH&RPPLWWHH¶VDFWLYLWLHVGXULQJWKHSUHYLRXVyear, its
review and recommendations relative to fiscal or performance audits, and any recommendations made to the $XWKRULW\
%RDUGIRULPSOHPHQWLQJWKHH[SHQGLWXUHSODQ7KHUHSRUWZLOOEHQRWLFHGLQORFDOPHGLDRXWOHWVWKURXJKRXW&RQWUD&RVWD&RXQW\
SRVWHGWRWKH$XWKRULW\:HEVLWHDQGPDGHFRQWLQXRXVO\DYDLODEOHIRUSXEOLFLQVSHFWLRQDW$XWKRULW\offices. The report shall be
composed of easy to understand language not in an overly technical format. The Committee VKDOOPDNHDQDQQXDO
SUHVHQWDWLRQWRWKH$XWKRULW\%RDUGVXPPDUL]LQJWKHDQQXDOUHSRUWVXEVHTXHQWWRLWVUHOHDVH
Committee members shall be selected to reflect community, business organizations and other interests within the
&RXQW\7KHJRDORIWKHPHPEHUVKLSPDNHXSRIWKH3XEOLF2YHUVLJKW&RPPLWWHHLVWRSURYLGHDEDODQFHRIYLHZSRLQWV
LQFOXGLQJEXWQRWOLPLWHGWRJHRJUDSK\DJHJHQGHUHWKQLFLW\DQGLQFRPHVWDWXVWRUHSUHVHQWWKHGLIIHUHQWSHUVSHFWLYHV
RIWKHUHVLGHQWVRI&RQWUD&RVWD&RXQW\2QHPHPEHUZLOOEHQRPLQDWHGE\HDFKRIWKHIRXUVXEUHJLRQVZLWKWKH573&
UHSUHVHQWLQJWKHVXEUHJLRQQRPLQDWLQJWKHPHPEHU7KH%RDUGRI6XSHUYLVRUVZLOOQRPLQDWHIRXUPHPEHUVZLWKHDFKRI
WKHVHIRXUPHPEHUVUHVLGLQJLQDQGUHSUHVHQWLQJRQHRIWKHFRXQW\¶VIRXUVXEUHJLRQV(LJKWPHPEHUVZLOOEHQRPLQDWHG
E\HDFKUHVSHFWLYHRUJDQL]DWLRQGHWDLOHGKHUHZLWKHDFKKDYLQJRQHUHSUHVHQWDWLYH /HDJXHRI:RPHQ¶V9RWHUV&RQWUD
&RVWD7D[SD\HUV$VVRFLDWLRQ(DVW%D\/HDGHUVKLS&RXQFLO%XLOGLQJDQG&RQVWUXFWLRQ7UDGHV&RXQFLO&HQWUDO/DERU&RXQFLO
3DUDWUDQVLW&RRUGLQDWLQJ&RXQFLO%LNH(DVW%D\DQGHQYLURQPHQWDODQGRURSHQVSDFHRUJDQL]DWLRQVRSHUDWLQJin Contra
Costa County (specific organization may vary during the life of the measure). About one half of the initial PHPEHU
DSSRLQWPHQWVZLOOEHIRUWZR\HDUVDQGWKHUHPDLQLQJDSSRLQWPHQWVZLOOEHIRUWKUHH\HDUWHUPV7KHUHDIWHUPHPEHUVZLOO
EHDSSRLQWHGWRWZR\HDUWHUPV$Q\LQGLYLGXDOPHPEHUFDQVHUYH RQWKH&RPPLWWHHIRUQRPRUHWKDQFRQVHFXWLYH\HDUV
Committee members will be Contra Costa County residents who are not elected officials at any level of government or
public employees from agencies that either oversee or benefit from the proceeds of the Measure. Membership LV
UHVWULFWHGWRLQGLYLGXDOVZLWKQRHFRQRPLFLQWHUHVWLQDQ\RI$XWKRULW\¶VSURMHFWVRUSURJUDPV,IDPHPEHU¶VVWDWXVFKDQJHVVR
WKDWKHVKHQRORQJHUPHHWWKHVHUHTXLUHPHQWVRULIDPHPEHUUHVLJQVKLVKHUSRVLWLRQRQWKH&RPPLWWHHthe Authority Board
will issue a new statement of interest from the same stakeholder category to fill the vacant position.
7KH&RPPLWWHHVKDOOPHHWXSWRRQFHDPRQWKWRFDUU\RXWLWVUHVSRQVLELOLW\DQGVKDOOPHHWDWOHDVWRQFHHYHU\PRQWKV
0HHWLQJVVKDOOEHKHOGDWWKHVDPHORFDWLRQDVWKH$XWKRULW\%RDUGPHHWLQJVDUHXVXDOO\KHOGVKDOOEHRSHQWRWKHSXEOLFDQG
PXVWEHKHOGLQFRPSOLDQFHZLWK&DOLIRUQLD¶VRSHQPHHWLQJODZ %URZQ$FW 0HHWLQJVVKDOOEHUHFRUGHGDQGWKHUHFRUGLQJVVKDOO
EHSRVWHGIRUWKHSXEOLF
0HPEHUVDUHH[SHFWHGWRDWWHQGDOOPHHWLQJV,IDPHPEHUZLWKRXWJRRGUHDVRQDFFHSWDEOHWRWKH&KDLURIWKH&RPPLWWHHIDLOV
WRDWWHQGHLWKHU D WZRRUPRUHFRQVHFXWLYHPHHWLQJVRU E PRUHWKDQPHHWLQJVD\HDUWKH$XWKRULW\%RDUGZLOOUHTXHVWD
UHSODFHPHQWIURPWKHVWDNHKROGHUFDWHJRULHVOLVWHGDERYH
7KH$XWKRULW\FRPPLWVWRVXSSRUWWKHRYHUVLJKWSURFHVVWKURXJKFRRSHUDWLRQZLWKWKH&RPPLWWHHE\SURYLGLQJDFFHVVWRSURMHFW
DQGSURJUDPLQIRUPDWLRQDXGLWVDQGRWKHULQIRUPDWLRQDYDLODEOHWRWKH$XWKRULW\DQGZLWKORJLVWLFDOVXSSRUWVRWKDWWKH
&RPPLWWHHPD\HIIHFWLYHO\SHUIRUPLWVRYHUVLJKWIXQFWLRQ7KH&RPPLWWHHZLOOKDYHIXOODFFHVVWR$XWKRULW\¶Vindependent
auditors, and may request Authority staff briefings for any information that is relevant to the Measure. The &RPPLWWHH
&KDLUVKDOOLQIRUPWKH$XWKRULW\%RDUG&KDLUDQG([HFXWLYH'LUHFWRURIDQ\FRQFHUQUHJDUGLQJ$XWKRULW\VWDII¶VFRPPLWPHQWWR
RSHQFRPPXQLFDWLRQWKHWLPHO\VKDULQJRILQIRUPDWLRQDQGWHDPZRUN
7KH&RPPLWWHHVKDOOQRWKDYHWKHDXWKRULW\WRVHWSROLF\RUDSSURSULDWHRUZLWKKROGIXQGVQRUVKDOOLWSDUWLFLSDWHLQRULQWHUIHUH
ZLWKWKHVHOHFWLRQSURFHVVRIDQ\FRQVXOWDQWRUFRQWUDFWRUKLUHGWRLPSOHPHQWWKHH[SHQGLWXUHSODQ
7KH&RPPLWWHHVKDOOQRWUHFHLYHPRQHWDU\FRPSHQVDWLRQH[FHSWIRUWKHUHLPEXUVHPHQWRIWUDYHORURWKHULQFLGHQWDOH[SHQVHV
LQDPDQQHUFRQVLVWHQWZLWKRWKHU$XWKRULW\DGYLVRU\FRPPLWWHHV
FFWDQHW11 &RQWUD&RVWD7UDQVSRUWDWLRQ$XWKRULW\T #&&7$fl FFWDQHW\RXWXEH
1.6-1906-10-19 TWIC Meeting Agenda
Packet Pg.182 of 192
7D[SD\HU6DIHJXDUGVDQG$FFRXQWDELOLW\
In order to ensure that the oversight by the Committee continues to be as effective as possible, the efficacy of the
&RPPLWWHH¶V&KDUWHU LHWKLVGRFXPHQW ZLOOEHHYDOXDWHGRQDSHULRGLFEDVLVDQGDIRUPDOUHYLHZZLOOEHFRQGXFWHGE\WKH
Authority Board, Executive Director and the Committee a minimum of every five years to determine if any amendments
WRWKLV&KDUWHUVKRXOGEHPDGH7KHIRUPDOUHYLHZZLOOLQFOXGHDEHQFKPDUNLQJRIWKH&RPPLWWHH¶VDFWLYLWLHVDQGFKDUWHUZLWK
RWKHUEHVWLQFODVVRYHUVLJKWFRPPLWWHHV$PHQGPHQWVWRWKLV&KDUWHUVKDOOEHSURSRVHGE\WKH&RPPLWWHHDQGDGRSWHGRU
UHMHFWHGE\WKH$XWKRULW\%RDUG
7KH&RPPLWWHHUHSODFHVWKH$XWKRULW\¶VH[LVWLQJ&LWL]HQV$GYLVRU\&RPPLWWHH
Advisory Committees
7KH$XWKRULW\ZLOOFRQWLQXHWKHFRPPLWWHHVWKDWZHUHHVWDEOLVKHG DV SDUW RI WKH 7UDQVSRUWDWLRQ 3DUWQHUVKLS &RPPLVVLRQ
RUJDQL]DWLRQDVZHOODVRWKHUFRPPLWWHHVWKDWKDYHEHHQXWLOL]HGE\WKH$XWKRULW\WRDGYLVHDQGDVVLVWLQSROLF\GHYHORSPHQWDQG
LPSOHPHQWDWLRQ7KHFRPPLWWHHVLQFOXGH
7KH5HJLRQDO7UDQVSRUWDWLRQ3ODQQLQJ&RPPLWWHHVWKDWZHUHHVWDEOLVKHGWRGHYHORSWUDQVSRUWDWLRQSODQVRQDJHRJUDSKLFEDVLV
IRUVXEDUHDVRIWKH&RXQW\DQG
x 7KH7HFKQLFDO&RRUGLQDWLQJ&RPPLWWHHWKDWZLOOVHUYHDVWKH$XWKRULW\¶VWHFKQLFDODGYLVRU\FRPPLWWHH
x 7KH3DUDWUDQVLW&RRUGLQDWLQJ&RXQFLO
x 7KH%LF\FOHDQG3HGHVWULDQ$GYLVRU\&RPPLWWHH
x %XV7UDQVLW&RRUGLQDWLQJ&RPPLWWHH
,03/(0(17,1**8,'(/,1(6
7KLV7UDQVSRUWDWLRQ([SHQGLWXUH3ODQ 3ODQ LVJXLGHGE\SULQFLSOHVWKDWHQVXUHWKHUHYHQXHJHQHUDWHGE\WKHVDOHVWD[is
spent only for the purposes outlined in this Plan in the most efficient and effective manner possible, consistent
with VHUYLQJWKHWUDQVSRUWDWLRQQHHGVRI&RQWUD&RVWD&RXQW\7KHIROORZLQJ,PSOHPHQWLQJ*XLGHOLQHVVKDOOJRYHUQWKH
DGPLQLVWUDWLRQ RI VDOHV WD[ UHYHQXHV E\ WKH $XWKRULW\ $GGLWLRQDO GHWDLO IRU FHUWDLQ ,PSOHPHQWLQJ *XLGHOLQHV LV IRXQG
HOVHZKHUHLQWKLV3ODQ
Duration of the Plan
7KHGXUDWLRQRIWKH3ODQVKDOOEHIRU\HDUVIURP$SULOWKURXJK0DUFK
Administration of the Plan
)XQGVRQO\3URMHFWVDQG3URJUDPVLQWKH3ODQ )XQGVFROOHFWHGXQGHUWKLV0HDVXUHPD\RQO\EHVSHQWIRUpurposes
identified in the Plan, as it may be amended by the Authority governing body. Identification of 3URMHFWVRU
3URJUDPVLQWKH3ODQGRHVQRWHQVXUHWKHLULPSOHPHQWDWLRQ$VDXWKRUL]HGWKH$XWKRULW\PD\DPHQGor delete
Projects and Programs identified in the Plan, including to provide for the use of additional federal, VWDWHDQG
ORFDOIXQGVWRDFFRXQWIRUXQH[SHFWHGUHYHQXHWRPDLQWDLQFRQVLVWHQF\ZLWKWKHFXUUHQW&RQWUD&RVWD&RXQW\ZLGH
7UDQVSRUWDWLRQ3ODQWRWDNHLQWRFRQVLGHUDWLRQXQIRUHVHHQFLUFXPVWDQFHVDQGWRDFFRXQWIRULPSDFWVDOWHUQDWLYHV
DQGSRWHQWLDOPLWLJDWLRQGHWHUPLQHGGXULQJUHYLHZXQGHUWKH&DOLIRUQLD(QYLURQPHQWDOQuality Act (CEQA) at such
time as each Project and Program is proposed for approval.
$OO'HFLVLRQV0DGHLQ3XEOLF3URFHVV: The Authority is given the fiduciary duty of administering the
WUDQVSRUWDWLRQVDOHVWD[SURFHHGVLQDFFRUGDQFHZLWKDOODSSOLFDEOHODZVDQGZLWKWKH3ODQ$FWLYLWLHVRIWKH
FFWDQHW11 &RQWUD&RVWD7UDQVSRUWDWLRQ$XWKRULW\T #&&7$fl FFWDQHW\RXWXEH
1.6-2006-10-19 TWIC Meeting Agenda
Packet Pg.183 of 192
7D[SD\HU6DIHJXDUGVDQG$FFRXQWDELOLW\
$XWKRULW\ZLOOEHFRQGXFWHGLQSXEOLFDFFRUGLQJWRVWDWHODZWKURXJKSXEOLFDOO\QRWLFHGPHHWLQJV7KHDQQXDOEXGJHWV
RI$XWKRULW\VWUDWHJLFSODQVDQGDQQXDOUHSRUWVZLOODOOEHSUHSDUHGIRUSXEOLFUHYLHZ7KHLQWHUHVWRIWKHSXEOLFZLOOEH
IXUWKHUSURWHFWHGE\D3XEOLF2YHUVLJKW&RPPLWWHHGHVFULEHGSUHYLRXVO\LQWKH3ODQ
6DODU\DQG$GPLQLVWUDWLRQ&RVW&DSV: Revenues may be expended by the Authority for salaries, wages, benefits,
RYHUKHDGDQGWKRVHVHUYLFHVLQFOXGLQJFRQWUDFWXDOVHUYLFHVQHFHVVDU\WRDGPLQLVWHUWKH0HDVXUH KRZHYHULQno case
shall the expenditures for the salaries and benefits of the staff necessary to perform administrative IXQFWLRQVIRU
WKH$XWKRULW\H[FHHGRQHKDOISHUFHQW RIUHYHQXHVIURPWKH0HDVXUH7KHDOORFDWHGFRVWVRIAuthority staff
who directly implement specific projects or programs are not included in the administrative costs.
([SHQGLWXUH3ODQ$PHQGPHQWV5HTXLUH0DMRULW\6XSSRUW 7KH$XWKRULW\PD\UHYLHZDQGSURSRVHDPHQGPHQWVWR
WKH([SHQGLWXUH3ODQDQGWKH*URZWK0DQDJHPHQW3URJUDPWRSURYLGHIRUWKHXVHRIDGGLWLRQDOIHGHUDOVWDWH
DQGORFDOIXQGVWRDFFRXQWIRUXQH[SHFWHGUHYHQXHVRUWRWDNHLQWRFRQVLGHUDWLRQXQIRUHVHHQFLUFXPVWDQFHV
$IIHFWHG5HJLRQDO7UDQVSRUWDWLRQ3ODQQLQJ&RPPLWWHH V ZLOOSDUWLFLSDWHLQWKHGHYHORSPHQWRIWKHSURSRVHG
DPHQGPHQW V $PDMRULW\RIWKH$XWKRULW\%RDUGLVUHTXLUHGWRDSSURYHDQDPHQGPHQWDQGDOOMXULVGLFWLRQV
ZLWKLQWKHFRXQW\ZLOOEHJLYHQDGD\SHULRGWRFRPPHQWRQDQ\SURSRVHG([SHQGLWXUH3ODQDPHQGPHQW
$XJPHQW7UDQVSRUWDWLRQ)XQGV )XQGVJHQHUDWHGSXUVXDQWWRWKH0HDVXUHDUHWREHXVHGWRVXSSOHPHQWDQGQRW
UHSODFHH[LVWLQJORFDOUHYHQXHVXVHGIRUWUDQVSRUWDWLRQSXUSRVHV$Q\IXQGVDOUHDG\DOORFDWHGFRPPLWWHGor
otherwise included in the financial plan for any project in the Plan shall be made available for project
development and implementation as required in the project’s financial and implementation program.
-XULVGLFWLRQ 7KH$XWKRULW\UHWDLQVVROHGLVFUHWLRQUHJDUGLQJLQWHUSUHWDWLRQFRQVWUXFWLRQDQGPHDQLQJRIZRUGVDQG
SKUDVHVLQWKH7UDQVSRUWDWLRQ([SHQGLWXUH3ODQ
Taxpayer Safeguards, Audits and Accountability
3XEOLF2YHUVLJKW&RPPLWWHH 7KH3XEOLF2YHUVLJKW&RPPLWWHHZLOOSURYLGHGLOLJHQWLQGHSHQGHQWDQGSXEOLFRYHUVLJKW
RIDOOH[SHQGLWXUHVRI0HDVXUHIXQGVE\$XWKRULW\RUUHFLSLHQWDJHQFLHV &RXQW\FLWLHVDQGWRZQVWUDQVLWRSHUDWRUV
HWF 7KH&RPPLWWHHZLOOUHSRUWWRWKHSXEOLFDQGIRFXVLWVRYHUVLJKWRQDQQXDODXGLWVWKHUHYLHZDQGDOORFDWLRQRI
0HDVXUHIXQGVWKHSHUIRUPDQFHRISURMHFWVDQGSURJUDPVLQWKH3ODQDQGFRPSOLDQFHE\ORFDOMXULVGLFWLRQVZLWK
WKHPDLQWHQDQFHRIHIIRUWDQG*URZWK0DQDJHPHQW3URJUDPGHVFULEHGSUHYLRXVO\LQWKH3ODQ
)LVFDO$XGLWV $OO)XQGVH[SHQGHGE\$XWKRULW\GLUHFWO\DQGDOOIXQGVDOORFDWHGE\IRUPXODRUGLVFUHWLRQDU\JUDQWVto
other entities are subject to fiscal audit. Recipients of Local Streets Maintenance & Improvements, Bus
Transit DQG2WKHU1RQ5DLO7UDQVLW(QKDQFHPHQWVRU7UDQVSRUWDWLRQIRU6HQLRUV 3HRSOH:LWK'LVDELOLWLHVSURJUDPV
IXQGLQJ LQFOXGLQJEXWQRWOLPLWHGWR&RXQW\FLWLHVDQGWRZQVDQGWUDQVLWRSHUDWRUV ZLOOEHDXGLWHGDWOHDVWRQFH
every five (5) years, conducted by an independent CPA. Any agency found to be in non-compliance shall have
LWVIRUPXODVDOHVWD[IXQGVZLWKKHOGXQWLOVXFKWLPHDVWKHDJHQF\LVIRXQGWREHLQFRPSOLDQFH
3HUIRUPDQFH$XGLWV 7KHIROORZLQJIXQGLQJFDWHJRULHVVKDOOEHVXEMHFWWRSHUIRUPDQFHDXGLWVE\WKH$XWKRULW\
Local Streets Maintenance and Improvements, Major Streets/Complete Streets/Traffic Signal
Synchronization 3URJUDP%XV7UDQVLWDQG2WKHU1RQ5DLO7UDQVLW(QKDQFHPHQWV7UDQVSRUWDWLRQIRU6HQLRUVDQG
3HRSOHZLWK'LVDELOLWLHV6DIH7UDQVSRUWDWLRQIRU&KLOGUHQ,QWHUFLW\5DLODQG)HUU\6HUYLFH3HGHVWULDQ%LF\FOHDQG
7UDLO)DFLOLWLHV&RPPXQLW\'HYHORSPHQW7UDQVSRUWDWLRQ3URJUDPDQG,QQRYDWLYH7UDQVSRUWDWLRQ7HFKQRORJ\
&RQQHFWHG&RPPXQLWLHV3URJUDP(DFK\HDUWKH$XWKRULW\VKDOOVHOHFWDQGSHUIRUPDIRFXVHGSHUIRUPDQFHDXGLW
RQWZRRUWKUHHRIWKHIXQGLQJFDWHJRULHVOLVWHGDERYHVRWKDWDWWKHHQGRIWKHIRXUWK\HDUDOOIXQGLQJFDWHJRULHV
OLVWHGDERYHDUHDXGLWHG7KLVSURFHVVVKDOOFRPPHQFHWZR\HDUVDIWHUSDVVDJHRIWKHQHZVDOHVWD[PHDVXUH
$GGLWLRQDO3HUIRUPDQFH$XGLWVVKDOOFRQWLQXHRQDVLPLODUF\FOHIRUWKHGXUDWLRQRIWKH3ODQ7KHSHUIRUPDQFH
DXGLWVVKDOOSURYLGHDQDFFXUDWHTXDQWLWDWLYHDQGTXDOLWDWLYHHYDOXDWLRQRIWKHIXQGLQJFDWHJRULHVWRGHWHUPLQHWKH
HIIHFWLYHQHVVLQPHHWLQJWKHSHUIRUPDQFHFULWHULDHVWDEOLVKHGE\WKH$XWKRULW\,QWKHHYHQW
FFWDQHW11 &RQWUD&RVWD7UDQVSRUWDWLRQ$XWKRULW\T #&&7$fl FFWDQHW\RXWXEH
1.6-2106-10-19 TWIC Meeting Agenda
Packet Pg.184 of 192
7D[SD\HU6DIHJXDUGVDQG$FFRXQWDELOLW\
WKDWDQ\SHUIRUPDQFHDXGLWGHWHUPLQHVWKDWDIXQGLQJFDWHJRU\LVQRWPHHWLQJWKHSHUIRUPDQFHUHTXLUHPHQWV
HVWDEOLVKHGE\WKH$XWKRULW\WKHDXGLWVKDOOLQFOXGHUHFRPPHQGDWLRQVIRUFRUUHFWLYHDFWLRQLQFOXGLQJEXWQRWOLPLWHG
WRUHYLVLRQVWR$XWKRULW\SROLFLHVRUSURJUDPJXLGHOLQHVWKDWJRYHUQWKHH[SHQGLWXUHRIIXQGV
0DLQWHQDQFHRI(IIRUW 02( )XQGVJHQHUDWHGE\WKHQHZVDOHVWD[0HDVXUHDUHWREHXVHGWRVXSSOHPHQWDQGQRW
UHSODFHH[LVWLQJORFDOUHYHQXHVXVHGIRUVWUHHWVDQGKLJKZD\VSXUSRVHV7KHEDVLVRIWKH02(UHTXLUHPHQWZLOOEHWKH
DYHUDJHRIH[SHQGLWXUHVRIDQQXDOGLVFUHWLRQDU\IXQGVRQVWUHHWVDQGKLJKZD\VDVUHSRUWHGWRWKH&RQWUROOHUpursuant
to Streets and Highways Code Section 2151 for the three most recent fiscal years before the passage of WKH
0HDVXUHZKHUHGDWDLVDYDLODEOH7KHDYHUDJHGROODUDPRXQWZLOOWKHQEHLQFUHDVHGRQFHHYHU\WKUHH\HDUVE\WKH
FRQVWUXFWLRQFRVWLQGH[RIWKDWWKLUG\HDU3HQDOW\IRUQRQFRPSOLDQFHRIPHHWLQJWKHPLQLPXP02(LVLPPHGLDWHORVV
RIDOO/RFDO6WUHHWV0DLQWHQDQFHDQG,PSURYHPHQWVIXQGVXQWLO02(FRPSOLDQFHLVDFKLHYHG7KHDXGLWRIWKHMOE
contribution shall be at least once every five years. Any agency found to be in non-compliance shall be subject
WRDQQXDODXGLWIRUWKUHH\HDUVDIWHUWKH\FRPHEDFNLQWRFRPSOLDQFH
$Q\ORFDOMXULVGLFWLRQZLVKLQJWRDGMXVWLWVPDLQWHQDQFHRIHIIRUWUHTXLUHPHQWVKDOOVXEPLWWRWKH$XWKRULW\DUHTXHVWIRU
DGMXVWPHQWDQGWKHQHFHVVDU\GRFXPHQWDWLRQWRMXVWLI\WKHDGMXVWPHQW7KH$XWKRULW\VWDIIVKDOOUHYLHZWKHUHTXHVW
DQGVKDOOPDNHDUHFRPPHQGDWLRQWRWKH$XWKRULW\7DNLQJLQWRFRQVLGHUDWLRQWKHUHFRPPHQGDWLRQWKH$XWKRULW\PD\
DGMXVWWKHDQQXDODYHUDJHRIH[SHQGLWXUHVUHSRUWHGSXUVXDQWWR6WUHHWVDQG+LJKZD\V&RGH6HFWLRQ7KH
$XWKRULW\VKDOOPDNHDQDGMXVWPHQWLIRQHRUPRUHRIWKHIROORZLQJFRQGLWLRQVH[LVWV
1. The local jurisdiction has undertaken one or more major capital projects during those fiscal years,
that UHTXLUHGDFFXPXODWLQJXQUHVWULFWHGUHYHQXHV LHUHYHQXHVWKDWDUHQRWUHVWULFWHGIRUXVHRQVWUHHWVDQG
highways such as general funds) to support the project during one or more fiscal years.
2.$VRXUFHRIXQUHVWULFWHGUHYHQXHXVHGWRVXSSRUWWKHPDMRUFDSLWDOSURMHFWRUSURMHFWVLVQRORQJHUDYDLODEOHWRWKH
ORFDOMXULVGLFWLRQDQGWKHORFDOMXULVGLFWLRQODFNVDXWKRULW\WRFRQWLQXHWKHXQUHVWULFWHGIXQGLQJVRXUFH
3.2QHRUPRUHVRXUFHVRIXQUHVWULFWHGUHYHQXHVWKDWZHUHDYDLODEOHWRWKHORFDOMXULVGLFWLRQLVSURGXFLQJless
than 95 percent of the amount produced in those fiscal years, and the reduction is not caused by
any GLVFUHWLRQDU\DFWLRQRIWKHORFDOMXULVGLFWLRQ
4.7KHORFDOMXULVGLFWLRQ3DYHPHQW&RQGLWLRQ,QGH[ 3&, LVRUJUHDWHUDVFDOFXODWHGE\WKHMXULVGLFWLRQ
3DYHPHQW0DQDJHPHQW6\VWHPDQGUHSRUWHGWRWKH0HWURSROLWDQ7UDQVSRUWDWLRQ&RPPLVVLRQ
$QQXDO%XGJHWDQG6WUDWHJLF3ODQ (DFK\HDUWKH$XWKRULW\ZLOODGRSWDQDQQXDOEXGJHWWKDWHVWLPDWHV
H[SHFWHGVDOHVWD[UHFHLSWVRWKHUDQWLFLSDWHGUHYHQXHDQGSODQQHGH[SHQGLWXUHVIRUWKH\HDU2QDSHULRGLF
EDVLVWKH$XWKRULW\ZLOODOVRSUHSDUHD6WUDWHJLF3ODQZKLFKZLOOLGHQWLI\WKHSULRULW\IRUSURMHFWV WKHGDWHIRU
SURMHFWLPSOHPHQWDWLRQEDVHGRQSURMHFWUHDGLQHVVDQGDYDLODELOLW\RISURMHFWIXQGLQJ WKHVWDWHIHGHUDODQG
RWKHUORFDOIXQGLQJFRPPLWWHGIRUSURMHFWLPSOHPHQWDWLRQDQGRWKHUUHOHYDQWFULWHULD7KHDQQXDOEXGJHWDQG
6WUDWHJLF3ODQZLOOEHDGRSWHGE\WKH$XWKRULW\%RDUGDWDSXEOLFPHHWLQJ
5HTXLUHPHQWVIRU)XQG5HFLSLHQWV $OOUHFLSLHQWVRIIXQGVDOORFDWHGLQWKLVH[SHQGLWXUHSODQZLOOEHUHTXLUHGWRsign a
Master Cooperative Agreement that defines reporting and accountability elements and as well as other
DSSOLFDEOHSROLF\UHTXLUHPHQWV$OOIXQGVZLOOEHDSSURSULDWHGWKURXJKDQRSHQDQGWUDQVSDUHQWSXEOLFSURFHVV
Geographic Equity 7KHSURSRVHGSURMHFWVDQGSURJUDPVWREHIXQGHGWKURXJKWKH3ODQFRQVWLWXWHD
³EDODQFHG´GLVWULEXWLRQRIIXQGLQJDOORFDWLRQVWRHDFKVXEUHJLRQLQ&RQWUD&RVWD&RXQW\+RZHYHUWKURXJK
WKHFRXUVHRIWKH0HDVXUHLIDQ\RIWKHSURMHFWVSURYHWREHLQIHDVLEOHRUFDQQRWEHLPSOHPHQWHGWKH
DIIHFWHGVXEUHJLRQPD\UHTXHVWWKDWWKH$XWKRULW\UHDVVLJQIXQGVWRDQRWKHUSURMHFWLQWKHVDPHVXEUHJLRQ
DVGHWDLOHGLQDQ$XWKRULW\)XQG$OORFDWLRQVSROLF\DQGWRPDLQWDLQD³EDODQFHG´GLVWULEXWLRQRIIXQGLQJ
DOORFDWLRQVWRHDFKVXEUHJLRQ
FFWDQHW11 &RQWUD&RVWD7UDQVSRUWDWLRQ$XWKRULW\T #&&7$fl FFWDQHW\RXWXEH
1.6-2206-10-19 TWIC Meeting Agenda
Packet Pg.185 of 192
7D[SD\HU6DIHJXDUGVDQG$FFRXQWDELOLW\
Restrictions On Funds
14. Expenditure Shall Benefit Contra Costa County 8QGHUQRFLUFXPVWDQFHPD\WKHSURFHHGVRIWKLVWUDQVSRUWDWLRQ
sales tax be applied for any purpose other than for transportation improvements benefitting residents of
Contra &RVWD&RXQW\8QGHUQRFLUFXPVWDQFHPD\WKHVHIXQGVEHDSSURSULDWHGE\WKH6WDWHRI&DOLIRUQLDRUDQ\RWKHU
local government agency as defined in the implementing guidelines.
15.(QYLURQPHQWDO5HYLHZ $OOSURMHFWVIXQGHGE\VDOHVWD[SURFHHGVDUHVXEMHFWWRODZVDQGUHJXODWLRQVRIIHGHUDOstate,
and local government, including the requirements of the California Environmental Quality Act (CEQA). 3ULRUWR
DSSURYDORUFRPPHQFHPHQWRIDQ\SURMHFWRUSURJUDPLQFOXGHGLQWKH3ODQDOOQHFHVVDU\HQYLURQPHQWDOreview
required by CEQA shall be completed.
16.3HUIRUPDQFHEDVHG3URMHFW5HYLHZ %HIRUHWKHDOORFDWLRQRIDQ\PHDVXUHIXQGVIRUWKHFRQVWUXFWLRQRIDSURMHFW
ZLWKDQHVWLPDWHGFDSLWDOFRVWLQH[FHVVRIPLOOLRQ RUHOHPHQWVRIDFRUULGRUSURMHFWZLWKDQRYHUDOOHVWLPDWHG
FRVWLQH[FHVVRIPLOOLRQ WKH$XWKRULW\ZLOO YHULI\WKDWWKHSURMHFWLVFRQVLVWHQWZLWKWKHDSSURYHG
&RXQW\ZLGH7UDQVSRUWDWLRQ3ODQ &73 DVLWPD\EHDPHQGHG YHULI\WKDWWKHSURMHFWLVLQFOXGHGLQWKH
5HJLRQDO7UDQVSRUWDWLRQ3ODQ6XVWDLQDEOH&RPPXQLWLHV6WUDWHJ\DQG UHTXLUHWKHSURMHFWVSRQVRUWRFRPSOHWH
DSHUIRUPDQFHEDVHGUHYLHZRISURMHFWDOWHUQDWLYHVSULRUWRWKHVHOHFWLRQRIDSUHIHUUHGDOWHUQDWLYH6DLG
SHUIRUPDQFHEDVHGUHYLHZZLOOLQFOXGHEXWQRWQHFHVVDULO\EHOLPLWHGWRDQDQDO\VLVRIWKHSURMHFWLPSDFWVRQ
JUHHQKRXVHJDVHPLVVLRQVYHKLFOHPLOHVWUDYHOOHGJRRGVPRYHPHQWHIIHFWLYHQHVVWUDYHOPRGHVKDUHGHOD\ E\
PRGH VDIHW\PDLQWHQDQFHRIWKHWUDQVSRUWDWLRQV\VWHPDQGFRQVLVWHQF\ZLWKDGRSWHG$XWKRULW\SODQVThe
Authority may require the evaluation of other performance criteria depending on the specific need and
SXUSRVHRIWKHSURMHFW:KHQDSSURSULDWHWKH$XWKRULW\ZLOOHQFRXUDJHSURMHFWVSRQVRUVWRLGHQWLI\DQGVHOHFWD
SURMHFWDOWHUQDWLYHWKDWUHGXFHVJUHHQKRXVHJDVHPLVVLRQVDVZHOODVYHKLFOHPLOHVWUDYHOOHGSHUFDSLWD7KH
$XWKRULW\ZLOODOVRSULRULWL]HDQGUHZDUGKLJKSHUIRUPLQJSURMHFWVE\OHYHUDJLQJDGGLWLRQDOUHJLRQDODQGRWKHU
IXQGLQJVRXUFHV7KH$XWKRULW\VKDOODGRSWGHWDLOHGJXLGHOLQHVIRUHYDOXDWLQJSURMHFWSHUIRUPDQFHDQGDSSO\LQJ
SHUIRUPDQFHFULWHULDLQWKHUHYLHZDQGVHOHFWLRQRIDSUHIHUUHGSURMHFWDOWHUQDWLYHQRODWHUWKDQ2FWREHU
17.&RXQW\ZLGH7UDQVSRUWDWLRQ3ODQ 6WDWHODZDOORZVHDFKFRXQW\LQWKH6DQ)UDQFLVFR%D\$UHDWKDWLVVXEMHFWWR
WKHMXULVGLFWLRQRIWKHUHJLRQDOWUDQVSRUWDWLRQSODQQLQJDJHQF\WRSUHSDUHD&RXQW\ZLGH7UDQVSRUWDWLRQ3ODQ
&73 IRUWKHFRXQW\DQGFLWLHVZLWKLQWKHFRXQW\%RWK0HDVXUH&DQG0HDVXUH-DOVRUHTXLUHWKH$XWKRULW\WR
SUHSDUHDQGSHULRGLFDOO\XSGDWHD&73IRU&RQWUD&RVWD6WDWHODZDOVRFUHDWHGDQLQWHUGHSHQGHQWUHODWLRQVKLS
EHWZHHQWKH&73DQGUHJLRQDOSODQQLQJDJHQF\(DFK&73PXVWFRQVLGHUWKHUHJLRQ¶VPRVWUHFHQWO\DGRSWHG
5HJLRQDO7UDQVSRUWDWLRQ3ODQ 573 DQG6XVWDLQDEOH&RPPXQLWLHV6WUDWHJ\ 6&6 ZKLOHWKHDGRSWHG&73VPXVW
IRUPWKH³SULPDU\EDVLV´IRUWKHQH[W573DQG6&67KH$XWKRULW\VKDOOIROORZDSSOLFDEOHVWDWXWHVDQGWKHPRVW
FXUUHQWJXLGHOLQHVIRUSUHSDULQJWKH&73DVHVWDEOLVKHGDQGSHULRGLFDOO\XSGDWHGE\WKHUHJLRQDOWUDQVSRUWDWLRQ
SODQQLQJDJHQF\7KH$XWKRULW\VKDOODOVRXVHWKH&73WRFRQYH\WKH$XWKRULW\¶VLQYHVWPHQWSULRULWLHVFRQVLVWHQW
ZLWKWKHORQJUDQJHYLVLRQRIWKH573DQG6&6
18.&RPSOHWH6WUHHWV 7KH$XWKRULW\KDVDGRSWHGDSROLF\UHTXLULQJDOOUHFLSLHQWVRIIXQGLQJWKURXJKWKLV3ODQWR
FRQVLGHUDQGDFFRPPRGDWHZKHUHYHUSRVVLEOHWKHQHHGVRIDOOXVHUVLQWKHSODQQLQJGHVLJQFRQVWUXFWLRQ
UHFRQVWUXFWLRQUHKDELOLWDWLRQDQGPDLQWHQDQFHRIWKHWUDQVSRUWDWLRQV\VWHP$FKLHYLQJWKLVYLVLRQZLOOUHTXLUH
EDODQFLQJWKHQHHGVRIGLIIHUHQWXVHUVDQGPD\UHTXLUHUHDOORFDWLQJH[LVWLQJULJKWRIZD\IRUGLIIHUHQWXVHV
19. Compliance with the Growth Management Program ,IWKH$XWKRULW\GHWHUPLQHVWKDWDMXULVGLFWLRQGRHVQRWFRPSO\
ZLWKWKHUHTXLUHPHQWVRIWKH*URZWK0DQDJHPHQW3URJUDPWKH$XWKRULW\VKDOOZLWKKROGIXQGVDQGDOVRmake a
finding that the jurisdiction shall not be eligible to receive Local Streets Maintenance & Improvements or
&RPPXQLW\'HYHORSPHQW7UDQVSRUWDWLRQ3URJUDP &'73 IXQGLQJXQWLOWKH$XWKRULW\GHWHUPLQHVWKHMXULVGLFWLRQKDV
DFKLHYHGFRPSOLDQFHDVGHWDLOHGLQWKH*URZWK0DQDJHPHQW3URJUDPVHFWLRQRIWKH3ODQ
FFWDQHW11 &RQWUD&RVWD7UDQVSRUWDWLRQ$XWKRULW\T #&&7$fl FFWDQHW\RXWXEH
1.6-2306-10-19 TWIC Meeting Agenda
Packet Pg.186 of 192
7D[SD\HU6DIHJXDUGVDQG$FFRXQWDELOLW\
Local Contracting and Good Jobs $XWKRULW\ZLOOGHYHORSDSROLF\VXSSRUWLQJWKHKLULQJRIORFDOFRQWUDFWRUVDQG
EXVLQHVVHVLQFOXGLQJSROLF\UHTXLULQJSUHYDLOLQJZDJHVDSSUHQWLFHVKLSSURJUDPVIRU&RQWUD&RVWDUHVLGHQWV
DQGYHWHUDQKLULQJSROLF\ VXFKDVWKH+HOPHWVWR+DUGKDWVSURJUDP WRWKHH[WHQWSHUPLWWHGE\ODZ7KH
$XWKRULW\ZLOODGRSWWKHDIRUHPHQWLRQHGSROLF\IRUSURMHFWVDQGSURJUDPVIXQGHGE\WKHPHDVXUHQRODWHUWKDQ
$SULO
1HZ$JHQFLHV 1HZFLWLHVRUQHZHQWLWLHV VXFKDVQHZWUDQVLWDJHQFLHV WKDWFRPHLQWRH[LVWHQFHLQ&RQWUD&RVWD
&RXQW\GXULQJWKHOLIHRIWKH3ODQPD\EHFRQVLGHUHGDVHOLJLEOHUHFLSLHQWVRIIXQGVWKURXJKD3ODQDPHQGPHQW
&RXQW\ZLGH7UDQVLW3ODQ 7KH$XWKRULW\ZLOOGHYHORSDFRXQW\ZLGHWUDQVLWSODQLGHQWLI\LQJVHUYLFHVDQGSURMHFWVWR
EHIXQGHGZLWKWKLV0HDVXUH7KHSODQZLOOEHLQFOXVLYHRIVHUYLFHVDQGSURMHFWVLQDGRSWHGSODQVRIH[LVWLQJ
WUDQVLWRSHUDWRUVZKLFKKDYHJRQHWKURXJKDSXEOLFUHYLHZSURFHVVSULRUWRDGRSWLRQ7KHSODQZLOOEHSHULRGLFDOO\
UHYLHZHGDQGXSGDWHG)XQGLQJZLOOEHDOORFDWHGE\WKH$XWKRULW\WKURXJKRXWWKH&RXQW\EDVHGRQLQSXWIURP
HDFK5HJLRQDO7UDQVSRUWDWLRQ3ODQQLQJ&RPPLWWHHDQGRQSHUIRUPDQFHFULWHULDHVWDEOLVKHGE\WKH$XWKRULW\LQ
FRQVXOWDWLRQZLWKORFDODQGUHJLRQDOEXVWUDQVLWRSHUDWRUVSURYLGHUVRIDOWHUQDWHQRQUDLOWUDQVSRUWDWLRQDQG
VWDNHKROGHUV6DLGSHUIRUPDQFHFULWHULDZLOOLQFOXGHDUHYLHZRILPSDFWRQ9HKLFOH0LOHVTraveled (VMT) and
Green-house Gas (GHG) and shall require a finding that any proposed new or enhanced VHUYLFHV
GHPRQVWUDWHWKHDELOLW\WRLPSURYHUHJLRQDODQGRUORFDOPRELOLW\IRU&RQWUD&RVWDUHVLGHQWV
Project Financing Guidelines and Managing Revenue
)LGXFLDU\'XW\ )XQGVPD\EHDFFXPXODWHGIRUODUJHURUORQJHUWHUPSURMHFWV,QWHUHVWLQFRPHJHQHUDWHGZLOOEHXVHG
IRUWKHSXUSRVHVRXWOLQHGLQWKH3ODQDQGZLOOEHVXEMHFWWRDXGLWV
3URMHFWDQG3URJUDP)LQDQFLQJ 7KH$XWKRULW\KDVWKHDXWKRULW\WRERQGIRUWKHSXUSRVHVRIH[SHGLWLQJWKH
delivery of transportation projects and programs. The Authority will develop a policy to identify financing
SURFHGXUHVIRUWKHHQWLUHSODQRISURMHFWVDQGSURJUDPV
3URJUDPPLQJRI9DULDWLRQVIURPWKH([SHFWHG5HYHQXH $FWXDOUHYHQXHVPD\DWWLPHVEHKLJKHURUORZHUWKDQ
H[SHFWHGLQWKLV3ODQGXHWRFKDQJHVLQUHFHLSWV$GGLWLRQDOIXQGVPD\EHFRPHDYDLODEOHGXHWRWKHLQFUHDVHG
RSSRUWXQLWLHVIRUOHYHUDJLQJRUSURMHFWFRVWVEHLQJOHVVWKDQH[SHFWHG5HYHQXHPD\EHORZHUWKDQH[SHFWHGas the
economy fluctuates. Determination of when the contingency funds become excess will be established by a
policy defined by the Authority. Funds considered excess will be prioritized first to expenditure plan projects
and programs, and second to other projects of regional significance that are consistent with the expenditure
SODQ7KHQHZSURMHFWRUSURJUDPZLOOEHUHTXLUHGWREHDPHQGHGLQWRWKHH[SHQGLWXUHSODQ
)XQG$OORFDWLRQV 7KURXJKWKHFRXUVHRIWKH0HDVXUHLIDQ\RIWKHSURMHFWVGRQRWUHTXLUHDOOIXQGVSURJUDPPHG
IRUWKDWSURMHFWRUKDYHH[FHVVIXQGLQJRUVKRXOGDSODQQHGSURMHFWEHFRPHXQGHOLYHUDEOHLQIHDVLEOHRU
XQIXQGDEOHGXHWRFLUFXPVWDQFHVXQIRUHVHHQDWWKHWLPHWKHH[SHQGLWXUHSODQZDVFUHDWHGIXQGLQJIRUWKDW
SURMHFWZLOOEHUHDOORFDWHGWRDQRWKHUSURMHFWRUSURJUDP7KHVXEUHJLRQZKHUHWKHSURMHFWRUSURJUDPLVORFDWHG
PD\UHTXHVWWKDWWKH$XWKRULW\UHDVVLJQIXQGVWRDQRWKHUSURMHFWLQWKHVDPHVXEUHJLRQ,QWKHDOORFDWLRQRIWKH
UHOHDVHGIXQGVWKH$XWKRULW\LQFRQVXOWDWLRQZLWKWKHVXEUHJLRQ573&ZLOOLQSULRULW\RUGHUFRQVLGHU
DSURMHFWRUSURJUDPRIWKHVDPHWUDYHOPRGH LHWUDQVLWELF\FOHSHGHVWULDQRUURDG LQWKHVDPHVXEUHJLRQ
DSURMHFWRUSURJUDPIRURWKHUPRGHVRIWUDYHOLQWKHVDPHVXEUHJLRQ RWKHUH[SHQGLWXUHSODQSURMHFWVRU
programs, and 4) other projects or programs of regional significance. The new project or program or funding
OHYHOPD\EHUHTXLUHGWREHDPHQGHGLQWRWKHH[SHQGLWXUHSODQ
/HYHUDJLQJ)XQGV /HYHUDJLQJRUPDWFKLQJRIRXWVLGHIXQGLQJVRXUFHVLVVWURQJO\HQFRXUDJHG$Q\DGGLWLRQDO
WUDQVSRUWDWLRQVDOHVWD[UHYHQXHVPDGHDYDLODEOHWKURXJKWKHLUUHSODFHPHQWE\PDWFKLQJIXQGVZLOOEHVSHQWEDVHG
RQWKHSULQFLSOHVRXWOLQHGIRUIXQGDOORFDWLRQVGHVFULEHGDERYH
FFWDQHW11 &RQWUD&RVWD7UDQVSRUWDWLRQ$XWKRULW\T #&&7$fl FFWDQHW\RXWXEH
1.6-2406-10-19 TWIC Meeting Agenda
Packet Pg.187 of 192
5/28/2019 Sacramento kids may soon be able to ride public transit for free
https://www.masstransitmag.com/bus/news/21082034/sacramento-kids-may-soon-be-able-to-ride-public-transit-for-free?utm_source=MASS+NewsVie…1/2
BUS | CA: SACRAMENTO KIDS MAY SOON BE ABLE TO RIDE PUBLIC TRANSIT FOR FREE
CA: Sacramento kids may soon be able to ride publictransit for free
More than 7,700 Sacramento City Unified School District students, about 16 percent, were
"chronically absent" from school last year, missing more than 10 percent of school days, according
to data from the district.
THERESA CLIFT MAY 24, 2019
THE SACRAMENTO BEE
May 24-- May 24--More than 7,700 Sacramento City Unified School District students, about 16
percent, were "chronically absent" from school last year, missing more than 10 percent of school
days, according to data from the district. That's higher than the statewide average of 11 percent.
Not having access to transportation is the top reason kids miss school, Sacramento City
Councilman Jay Schenirer says.
That's why he is proposing to let all children in kindergarten through 12th grade who live or go to
school in Sacramento ride public transit -- buses and light rail -- for free.
Sacramento would be only the second city in the country that offers K-12 students free rides
yearlong without restrictions, following Washington, D.C., which launched it last year, Schenirer said.
Sacramento Regional Transit estimates the program would increase ridership to 40,000 students in
its first year, a 600% increase from today, Schenirer said. The councilman hopes many children who
take the free transit would continue on as transit riders as adults, which helps reduce greenhouse
gases.
"The hope is you're changing culture and habit," Schenirer said. "If we have more young people riding,
research shows the chance of them being public transit riders when they are adults is much higher."
Schenirer said the free passes, which would be issued with a sticker on student ID cards, would also
make it easier for kids to get to part-time jobs and internships, which helps with workforce
development.
The program would cost RT about $30 million, Schenirer said. The RT board has committed $29
million toward operations and revenue loss. The program would also cost the city $1 million,
Schenirer said. He is asking the city manager to add it to his proposed fiscal year 2019-20 budget.
That would fund the program for one year, with the expectation it would continue in the future,
Schenirer said.
2.1-106-10-19 TWIC Meeting Agenda
Packet Pg.188 of 192
5/28/2019 Sacramento kids may soon be able to ride public transit for free
https://www.masstransitmag.com/bus/news/21082034/sacramento-kids-may-soon-be-able-to-ride-public-transit-for-free?utm_source=MASS+NewsVie…2/2
The RT board plans to vote on the program June 10, while the council plans to vote to adopt the
budget June 11, Schenirer said.
If approved, the program could begin in the fall, Schenirer said.
Councilwoman Angelique Ashby said she supports the idea.
"I think it's really important, especially getting around the central city and getting around
Meadowview to downtown," Ashby said. "I think that's critical."
Schenirer plans on including the Jibe express buses in the program, he said. Those buses run from
North Natomas in Ashby's district to downtown for $2 per ride.
Researchers at the University of Texas at Austin have tentatively agreed to do a study, for about
$80,000, on how the free transit will affect kids getting to school and after-school enrichment
activities, as well as the impact on their attitudes toward public transit in general.
___ (c)2019 The Sacramento Bee (Sacramento, Calif.) Visit The Sacramento Bee (Sacramento, Calif.)
at www.sacbee.com Distributed by Tribune Content Agency, LLC.
2.1-206-10-19 TWIC Meeting Agenda
Packet Pg.189 of 192
Contra Costa County: Paratransit Policies/Guidance 2004 ‐ 2013
Highlighted policies/recommendations have not been implemented.
Measure J 2008 Transportation Expenditure Plan ‐ Excerpts
Transportation for Seniors & People with Disabilities funds shall be available for
(a) managing the program,
(b) retention of a mobility manager,
(c) coordination with non‐profit services,
(d) establishment and/or maintenance of a comprehensive paratransit technology
implementation plan, and
(e) facilitation of countywide travel and integration with fixed route and BART specifically, as
deemed feasible.
Paratransit Improvement Study 2004 ‐ Excerpts
“At this time, the consulting team recommends the continued delivery of ADA paratransit
services in Contra Costa under the current decentralized* model. Under the current model,
improvements to service efficiency and service quality are possible through the implementation
of selected elements from the following “toolbox” of service strategies.”
*County Staff Note: The approach recommended in the 2004 study, “…continued
delivery…under the current decentralized model…improvements to service efficiency…service
quality” was subsequently identified as a flawed approach in the 2013 Study, “…lack of a
structural platform…major impediment to action…”
6.4.2 ESTABLISHMENT OF A SEPARATE OPERATING ENTITY TO COORDINATE TRANSFERS
6.4.4 STANDARDIZATION OF ADMINISTRATIVE, OPERATIONAL AND SERVICE DELIVERY
POLICIES AND PROCESSES
6.4.4.1 Standard Policies Regarding Scheduling Parameters (including advance booking
times, application of scheduling windows, etc.)
6.4.4.2 Automating Scheduling of Inter‐Agency Transfers
6.4.4.3 Allocate a Dedicated Fleet of Vehicles for Inter‐Agency Transfers
6.4.8 COORDINATION OF COMMUNITY‐BASED AGENCY TRANSPORTATION
A mobility manager is a transportation organization serving the general public that
responds to and influences the demands of the market by undertaking actions and
supportive strategies, directly or in collaboration with others.
The mobility management function may assume one or more of the following
responsibilities:
Centralized information dissemination and referral service ‐
Support services
Brokerage service
6.4.9 TECHNOLOGY ROLE
Trip Planning
AVL Implementation
MDT Implementation
Coordinated Client Data Management
IVR implementation
06-10-19 TWIC Meeting Agenda
Packet Pg.190 of 192
Contra Costa Mobility Management Plan 2013 ‐ Excerpts
The plan has broad support from CCTA, Contra Costa transit operators, and human service
agencies.
This Plan recommends the formation of an organization to take the lead in implementing a
broad range of mobility management strategies. Specifically, a Consolidated Transportation
Services Agency (CTSA) is recommended for Contra Costa County. Further, careful consideration
has been given to alternative legal structures for a CTSA. The result of that dialog has been the
agreement to pursue a non‐profit corporation model. The principal basis for recommending this
structural model is the level of success in other communities that have adopted this structure.
The planning process identified that a major impediment to action is the lack of a structural
platform to serve as the vehicle through which action is accomplished. That vehicle has now been
identified as a Consolidated Transportation Services Agency (CTSA).
Of the models presented above the non‐profit agency model has historically been the most
notable in terms of implementing programs with long‐term sustainability. Non‐profit agencies
such as Outreach1 and Escort, Ride‐On, and Paratransit, Inc. have delivered successful
coordinated transportation programs throughout California for many years. Each of these
organizations continues to evolve to meet the needs of the communities they serve. Non‐profit
organizations have typically been the most successful CTSA model for a number of specific
reasons.
1 Relative to the claims of fraud by the Valley Transportation Authority and subsequent raid by the FBI of Outreach
Paratransit in 2016, an audit in 2018 by the County of Santa Clara found no wrongdoing. No charges were filed.
06-10-19 TWIC Meeting Agenda
Packet Pg.191 of 192
Community Development Transportation Program
In order to provide more places for Contra Costa County residents to work closer to where they
live, improve their commute options, and have a better quality of life, this category is intended to
provide funding to implement a new Community Development Transportation Program (CDTP)
to be administered by the Authority in conjunction with the Authority’s existing Transportation
for Livable Communities Program (TLC) with projects identified by the Authority’s Regional
Transportation Planning Committees (RTPCs). No less than half the funds in this program will
be allocated by the Authority on a competitive basis to transportation capital projects that support
and sustain existing and new jobs in Contra Costa County. The remainder of funds will be
allocated by the Authority on a competitive basis to transportation capital projects that that
promote access to affordable infill housing within The funds must be spent on infrastructure (on-
or off-site) that directly improve multimodal access to the employment or housing site(s).
Examples of potentially eligible use of funds (for illustrative purposes only) include new or
upgraded rail crossings to “unlock” development potential, freight rail improvements, multilevel
or underground parking structures, bike lanes and bike facilities in industrial parks and on routes
from transit stations to industrial areas or other underserved areas.
All projects will be selected through a competitive process, either within each subregion with the
Authority approving the final program of projects, or by the Authority for projects of countywide
significance, allowing for a comprehensive approach while recognizing subregional needs to
achieve the overall program goal – improved jobs-housing balance in Contra Costa County.
Project sponsors must demonstrate that at least 20 percent of the project costs are funded from
non-local transportation sales tax revenue; unless sponsor demonstrates the project is of regional
significance by its inclusion in regional plans and/or support from agencies in other subregions.
Additional priority will be given to projects that create new employment opportunities along the
Highway 4 corridor, in order to decrease congestion and commute times and use the counter-
commute transit capacity, and to housing and jobs projects located in jurisdictions that have met
at least a pro-rata portion of their RHNA targets, and are compliant with annual Housing
Element reporting requirements as determined by the State of California.
Working with the RTPCs, the Authority will prepare guidelines and establish overall criteria for
the program with the intent of complementing and administering the program in conjunction
with the Authority’s Measure J TLC program no later than December 31, 20XX.
06-10-19 TWIC Meeting Agenda
Packet Pg.192 of 192